esxJ Resolved · high auto-curated
H37Rv Rv1038c · MTBC0 mtbc0_001115 ·
98 aa · 1168192–1168488 (-) ·
RefSeq NP_215554.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxJ |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system ESX-5 protein EsxJ |
| Revised (this work) | Type VII secretion system ESX-5 protein EsxJ. Pfam: WXG100 (PF06013.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WNJ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxJ |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | esxP |
| eggNOG description | Belongs to the WXG100 family |
| Orthologous group | COG4842 |
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 2.3e-20 | 5–90 | Proteins of 100 residues with WXG |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: esxI (ESAT-6 like protein EsxI), high confidence from genomic context alone (score 940 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1037c esxI |
ESAT-6 like protein EsxI | 981 | 940 ctx | neighborhood:703 coexpression:805 textmining:711 |
Rv1198 esxL |
ESAT-6 like protein EsxL | 954 | 865 | coexpression:860 textmining:679 |
Rv2346c esxO |
ESAT-6 like protein EsxO | 954 | 865 | coexpression:860 textmining:679 |
Rv1793 esxN |
ESAT-6 like protein EsxN | 935 | 865 | coexpression:860 textmining:542 |
Rv1197 esxK |
ESAT-6 like protein EsxK | 861 | 860 | coexpression:860 |
Rv2347c esxP |
ESAT-6 like protein EsxP | 860 | 860 | coexpression:860 |
Rv3620c esxW |
ESAT-6 like protein EsxW | 860 | 860 | coexpression:860 |
Rv3619c esxV |
ESAT-6 like protein EsxV | 892 | 853 | coexpression:848 |
Rv3648c cspA |
cold shock protein A | 826 | 826 | coexpression:824 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 910 | 813 | coexpression:813 textmining:540 |
Rv3875 esxA |
ESAT-6 protein EsxA | 910 | 800 | coexpression:800 textmining:569 |
Rv0685 tuf |
elongation factor Tu | 778 | 778 | coexpression:778 |
Rv1196 PPE18 |
PPE family protein PPE18 | 787 | 744 | coexpression:744 |
Rv0288 esxH |
ESAT-6-like protein EsxH | 836 | 703 | coexpression:703 textmining:473 |
Rv0287 esxG |
ESAT-6 like protein EsxG | 667 | 512 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxJ
- MTBC0 PGAP product: type VII secretion system ESX-5 protein EsxJ
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=2e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215554.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4842 - Curated reference: UniProt P9WNJ9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
esxI - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001115|Rv1038c|esxJ MASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS