Rv0919 Family assigned · medium auto-curated

H37Rv Rv0919 · MTBC0 mtbc0_000976 · 166 aa · 1027899–1028399 (+) · RefSeq NP_215434.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GCN5-like N-acetyltransferase
MTBC0 PGAP re-annotationGNAT family N-acetyltransferase
Revised (this work)GNAT family N-acetyltransferase. Pfam: Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XA42 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA-acetylating toxin
EC (curated) EC 2.3.1.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Overexpression of this gene alone in M.smegmatis inhibits growth, while overexpression of the tacA-tacT operon does not. Acetylates glycyl-tRNA(Gly) but not other tRNAs, blocks in vitro translation in the presence, but not absence, of acetyl-coenzyme A. Peptidyl-tRNA hydrolase (pth) counteracts the product of this enzyme in vitro. Neutralized by cognate antitoxin TacA. Does not seem to be active in laboratory growth conditions..; FUNCTION: TacA-TacT both represses and derepresses expression of its own operon.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionAcetyltransferase (GNAT) domain
Orthologous groupCOG0454

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.026 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_10PF13673.14 6.7e-0827–144 Acetyltransferase (GNAT) domain
Acetyltransf_1PF00583.32 7.7e-1033–143 Acetyltransferase (GNAT) family
Acetyltransf_7PF13508.14 1.1e-0942–144 Acetyltransferase (GNAT) domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC30 (ribonuclease VapC30), medium confidence from genomic context alone (score 500 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0918 hyp hypothetical protein 973 973 ctx neighborhood:801 cooccurence:767 experimental:451
Rv2803 hyp hypothetical protein 517 515 experimental:451
Rv0624 vapC30 ribonuclease VapC30 499 500 ctx cooccurence:495
Rv1982c vapC36 ribonuclease VapC36 492 492 ctx cooccurence:492
Rv0609 vapC28 ribonuclease VapC28 480 480 ctx cooccurence:477
Rv2759c vapC42 ribonuclease VapC42 475 475 ctx cooccurence:472
Rv0597c hyp hypothetical protein 453 453 ctx cooccurence:450
Rv3421c tsaB hyp hypothetical protein 480 448
Rv3294c hyp hypothetical protein 443 443 ctx cooccurence:436
Rv2008c hyp hypothetical protein 433 434 ctx cooccurence:430
Rv3179 hyp hypothetical protein 424 425 ctx cooccurence:421
Rv0917 betP glycine betaine transport integral membrane protein BetP 419 397

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GCN5-like N-acetyltransferase
  • MTBC0 PGAP product: GNAT family N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_10 PF13673.14 (E=7e-08), Acetyltransf_1 PF00583.32 (E=8e-10), Acetyltransf_7 PF13508.14 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215434.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0454
  • Curated reference: UniProt I6XA42 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor vapC30
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000976|Rv0919|
MSGYSAPRRISDADDVTSFSSGEPSLDDYLRKRALANHVQGGSRCFVTCRDGRVVGFYALASGSVAHADAPGRVRRNMPDPVPVILLSRLAVDRKEQGRGLGSHLLRDAIGRCVQAADSIGLRAILVHALHDEARAFYVHFDFEISPTDPLHLMLLMKDARALIGD