Rv0919 Family assigned · medium auto-curated
H37Rv Rv0919 · MTBC0 mtbc0_000976 ·
166 aa · 1027899–1028399 (+) ·
RefSeq NP_215434.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | GNAT family N-acetyltransferase |
| Revised (this work) | GNAT family N-acetyltransferase. Pfam: Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XA42
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | tRNA-acetylating toxin |
| EC (curated) |
EC 2.3.1.-
|
| Curated function | Toxic component of a type II toxin-antitoxin (TA) system. Overexpression of this gene alone in M.smegmatis inhibits growth, while overexpression of the tacA-tacT operon does not. Acetylates glycyl-tRNA(Gly) but not other tRNAs, blocks in vitro translation in the presence, but not absence, of acetyl-coenzyme A. Peptidyl-tRNA hydrolase (pth) counteracts the product of this enzyme in vitro. Neutralized by cognate antitoxin TacA. Does not seem to be active in laboratory growth conditions..; FUNCTION: TacA-TacT both represses and derepresses expression of its own operon. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Acetyltransferase (GNAT) domain |
| Orthologous group | COG0454 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.026 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_10 | PF13673.14 | 6.7e-08 | 27–144 | Acetyltransferase (GNAT) domain |
Acetyltransf_1 | PF00583.32 | 7.7e-10 | 33–143 | Acetyltransferase (GNAT) family |
Acetyltransf_7 | PF13508.14 | 1.1e-09 | 42–144 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: vapC30 (ribonuclease VapC30), medium confidence from genomic context alone (score 500 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0918 hyp |
hypothetical protein | 973 | 973 ctx | neighborhood:801 cooccurence:767 experimental:451 |
Rv2803 hyp |
hypothetical protein | 517 | 515 | experimental:451 |
Rv0624 vapC30 |
ribonuclease VapC30 | 499 | 500 ctx | cooccurence:495 |
Rv1982c vapC36 |
ribonuclease VapC36 | 492 | 492 ctx | cooccurence:492 |
Rv0609 vapC28 |
ribonuclease VapC28 | 480 | 480 ctx | cooccurence:477 |
Rv2759c vapC42 |
ribonuclease VapC42 | 475 | 475 ctx | cooccurence:472 |
Rv0597c hyp |
hypothetical protein | 453 | 453 ctx | cooccurence:450 |
Rv3421c tsaB hyp |
hypothetical protein | 480 | 448 | |
Rv3294c hyp |
hypothetical protein | 443 | 443 ctx | cooccurence:436 |
Rv2008c hyp |
hypothetical protein | 433 | 434 ctx | cooccurence:430 |
Rv3179 hyp |
hypothetical protein | 424 | 425 ctx | cooccurence:421 |
Rv0917 betP |
glycine betaine transport integral membrane protein BetP | 419 | 397 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: GNAT family N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_10 PF13673.14 (E=7e-08), Acetyltransf_1 PF00583.32 (E=8e-10), Acetyltransf_7 PF13508.14 (E=1e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215434.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt I6XA42 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
vapC30 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000976|Rv0919| MSGYSAPRRISDADDVTSFSSGEPSLDDYLRKRALANHVQGGSRCFVTCRDGRVVGFYALASGSVAHADAPGRVRRNMPDPVPVILLSRLAVDRKEQGRGLGSHLLRDAIGRCVQAADSIGLRAILVHALHDEARAFYVHFDFEISPTDPLHLMLLMKDARALIGD