cmtR Family assigned · medium auto-curated

H37Rv Rv1994c · MTBC0 mtbc0_002121 · 118 aa · 2261241–2261597 (-) · RefSeq NP_216510.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator CmtR
MTBC0 PGAP re-annotationCd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR
Revised (this work)Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMI9 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator CmtR
Curated functionMetal-responsive transcriptional repressor for the cmt operon. Binding of cadmium or lead causes the repressor to dissociate from the DNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namecmtR
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG0640
KEGG orthology K21885
Gene Ontology (40) GO:0003674, GO:0003676, GO:0003677, GO:0003700, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010035, GO:0010038, GO:0010288, GO:0010468 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 3.8e-0818–64 Helix-turn-helix domain
HTH_5PF01022.27 1.1e-1620–64 Bacterial regulatory protein, arsR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ctpG (cation transporter ATPase G), high confidence from genomic context alone (score 780 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1992c ctpG cation transporter ATPase G 892 780 ctx neighborhood:663 textmining:533
Rv1993c hyp hypothetical protein 935 684 ctx neighborhood:680 textmining:805
Rv1995 hyp hypothetical protein 732 539 ctx neighborhood:528 textmining:443
Rv2640c ArsR family transcriptional regulator 680 462 ctx cooccurence:454 textmining:431
Rv2643 arsC arsenic-transport integral membrane protein ArsC 511 438
Rv1991c mazF6 mRNA interferase MazF6 435 435 ctx neighborhood:432
Rv2358 smtB HTH-type transcriptional regulator SmtB 797 433 ctx cooccurence:429 textmining:658
Rv1991A mazE6 antitoxin MazE6 462 432 ctx neighborhood:432
Rv3271c integral membrane protein 419 391
Rv1996 universal stress protein 401 379
Rv0827c kmtR HTH-type transcriptional regulator KmtR 671 352 textmining:513
Rv2034 ArsR family HTH-type transcriptional repressor 552 313
Rv0092 ctpA cation transporter ATPase A 412 278
Rv2641 cadI cadmium inducible protein CadI 498 118 textmining:455
Rv2025c cation efflux system protein 480 83 textmining:457

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator CmtR
  • MTBC0 PGAP product: Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=4e-08), HTH_5 PF01022.27 (E=1e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216510.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0640
  • Curated reference: UniProt P9WMI9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor ctpG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002121|Rv1994c|cmtR
MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTDQPCVAERAASGEAVEMTGS