Rv0921 Family assigned · medium auto-curated
H37Rv Rv0921 · MTBC0 mtbc0_000979 ·
193 aa · 1030319–1030900 (+) ·
RefSeq NP_215436.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | resolvase |
|---|---|
| MTBC0 PGAP re-annotation | IS607-like element IS1535 family transposase |
| Revised (this work) | IS607-like element IS1535 family transposase. Pfam: Resolvase (PF00239.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6WZS4
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible resolvase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| eggNOG description | Resolvase, N terminal domain |
| Orthologous group | COG2452 |
| KEGG orthology |
K07450
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.284 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Resolvase | PF00239.27 | 5.6e-21 | 52–188 | Resolvase, N terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: tnpB (transposase), high confidence from genomic context alone (score 958 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0922 tnpB |
transposase | 959 | 958 ctx | neighborhood:801 cooccurence:772 |
Rv3827c |
transposase | 778 | 773 ctx | cooccurence:762 |
Rv2791c tnpB |
transposase | 777 | 771 ctx | cooccurence:761 |
Rv2885c |
transposase | 777 | 771 ctx | cooccurence:761 |
Rv2978c tnpB |
transposase | 777 | 771 ctx | cooccurence:760 |
Rv0606 |
Possible transposase (fragment); Rv0606, (MTCY19H5.16c), len: 247 aa. Possible truncated transposase for IS_1536 element, highly similar to | 773 | 767 ctx | cooccurence:756 |
Rv0920c |
transposase | 442 | 442 ctx | neighborhood:440 |
Rv0071 |
maturase | 419 | 190 | |
Rv3334 |
MerR family transcriptional regulator | 647 | 52 | textmining:643 |
Rv0766c cyp123 |
cytochrome P450 Cyp123 | 414 | 47 | textmining:411 |
Rv0401 |
transmembrane protein | 613 | 44 | textmining:612 |
Rv2956 hyp |
hypothetical protein | 548 | 44 | textmining:547 |
Rv2566 hyp |
hypothetical protein | 611 | 41 | textmining:611 |
Rv1376 hyp |
hypothetical protein | 420 | 41 | textmining:420 |
Rv0008c cwsA |
cell wall synthesis protein CwsA | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: resolvase
- MTBC0 PGAP product: IS607-like element IS1535 family transposase
- Pfam (hmmscan --cut_ga): Resolvase PF00239.27 (E=6e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215436.1)
- Domains: Pfam-A via hmmscan --cut_ga — Resolvase (PF00239.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2452 - Curated reference: UniProt I6WZS4 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
tnpB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000979|Rv0921| MNLADWAESVGVNRHTAYRWFREGTLPVPAERVGRLILVKTAASASAAAAGVVLYARVSSHDRRSDLDRQVARLTAWATERDLGVGQVVCEVGSGLNGKRPKLRRILSDPDARVIVVEHRDRLARFGVEHLEAALSAQGRRIVVADPGETTDDLVCDMIEVLTGMCARLYGRRGARNRAMRAVTEAKREPGAG