Rv0921 Family assigned · medium auto-curated

H37Rv Rv0921 · MTBC0 mtbc0_000979 · 193 aa · 1030319–1030900 (+) · RefSeq NP_215436.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)resolvase
MTBC0 PGAP re-annotationIS607-like element IS1535 family transposase
Revised (this work)IS607-like element IS1535 family transposase. Pfam: Resolvase (PF00239.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WZS4 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible resolvase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionResolvase, N terminal domain
Orthologous groupCOG2452
KEGG orthology K07450

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.284 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ResolvasePF00239.27 5.6e-2152–188 Resolvase, N terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tnpB (transposase), high confidence from genomic context alone (score 958 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0922 tnpB transposase 959 958 ctx neighborhood:801 cooccurence:772
Rv3827c transposase 778 773 ctx cooccurence:762
Rv2791c tnpB transposase 777 771 ctx cooccurence:761
Rv2885c transposase 777 771 ctx cooccurence:761
Rv2978c tnpB transposase 777 771 ctx cooccurence:760
Rv0606 Possible transposase (fragment); Rv0606, (MTCY19H5.16c), len: 247 aa. Possible truncated transposase for IS_1536 element, highly similar to 773 767 ctx cooccurence:756
Rv0920c transposase 442 442 ctx neighborhood:440
Rv0071 maturase 419 190
Rv3334 MerR family transcriptional regulator 647 52 textmining:643
Rv0766c cyp123 cytochrome P450 Cyp123 414 47 textmining:411
Rv0401 transmembrane protein 613 44 textmining:612
Rv2956 hyp hypothetical protein 548 44 textmining:547
Rv2566 hyp hypothetical protein 611 41 textmining:611
Rv1376 hyp hypothetical protein 420 41 textmining:420
Rv0008c cwsA cell wall synthesis protein CwsA 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: resolvase
  • MTBC0 PGAP product: IS607-like element IS1535 family transposase
  • Pfam (hmmscan --cut_ga): Resolvase PF00239.27 (E=6e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215436.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Resolvase (PF00239.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2452
  • Curated reference: UniProt I6WZS4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor tnpB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000979|Rv0921|
MNLADWAESVGVNRHTAYRWFREGTLPVPAERVGRLILVKTAASASAAAAGVVLYARVSSHDRRSDLDRQVARLTAWATERDLGVGQVVCEVGSGLNGKRPKLRRILSDPDARVIVVEHRDRLARFGVEHLEAALSAQGRRIVVADPGETTDDLVCDMIEVLTGMCARLYGRRGARNRAMRAVTEAKREPGAG