Rv0912 Still unknown · low auto-curated
H37Rv Rv0912 · MTBC0 mtbc0_000967 ·
149 aa · 1019451–1019900 (+) ·
RefSeq NP_215427.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05904
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable conserved transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2AKTG |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0910 (toxin), medium confidence from genomic context alone (score 463 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0911 hyp |
hypothetical protein | 959 | 799 ctx | neighborhood:796 textmining:806 |
Rv0910 |
toxin | 464 | 463 ctx | neighborhood:460 |
Rv0909 |
antitoxin | 445 | 445 ctx | neighborhood:442 |
Rv0183 |
lysophospholipase | 661 | 64 | textmining:653 |
Rv2010 vapC15 |
ribonuclease VapC15 | 553 | 49 | textmining:550 |
Rv0180c |
transmembrane protein | 692 | 47 | textmining:691 |
Rv1731 gabD2 |
succinate-semialdehyde dehydrogenase | 654 | 47 | textmining:652 |
Rv2009 vapB15 |
antitoxin VapB15 | 653 | 47 | textmining:651 |
Rv0234c gabD1 |
succinate-semialdehyde dehydrogenase | 660 | 46 | textmining:659 |
Rv0887c hyp |
hypothetical protein | 809 | 44 | textmining:809 |
Rv0942 hyp |
hypothetical protein | 809 | 42 | textmining:809 |
Rv0181c hyp |
hypothetical protein | 808 | 41 | textmining:808 |
Rv0886 fprB |
ferredoxin/ferredoxin--NADP reductase | 547 | 41 | textmining:547 |
Rv0654 |
carotenoid cleavage oxygenase | 510 | 41 | textmining:510 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215427.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AKTG - Curated reference: UniProt O05904 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
Rv0910 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000967|Rv0912| MTRRLRPGWLVALSAAVIAASTWMPWLTTTVGGGGWVNAIGGTHGSLELPHGFGPGQLIVLLSSTLLVVGAMAGRGLSVKLSSIAALVVSLLIVALTVWYYKLNVNPPVSAEYGLYFGAAGGVCAVGCSLWAAVSAASPGRRRHREVVR