Rv0912 Still unknown · low auto-curated

H37Rv Rv0912 · MTBC0 mtbc0_000967 · 149 aa · 1019451–1019900 (+) · RefSeq NP_215427.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05904 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AKTG

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0910 (toxin), medium confidence from genomic context alone (score 463 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0911 hyp hypothetical protein 959 799 ctx neighborhood:796 textmining:806
Rv0910 toxin 464 463 ctx neighborhood:460
Rv0909 antitoxin 445 445 ctx neighborhood:442
Rv0183 lysophospholipase 661 64 textmining:653
Rv2010 vapC15 ribonuclease VapC15 553 49 textmining:550
Rv0180c transmembrane protein 692 47 textmining:691
Rv1731 gabD2 succinate-semialdehyde dehydrogenase 654 47 textmining:652
Rv2009 vapB15 antitoxin VapB15 653 47 textmining:651
Rv0234c gabD1 succinate-semialdehyde dehydrogenase 660 46 textmining:659
Rv0887c hyp hypothetical protein 809 44 textmining:809
Rv0942 hyp hypothetical protein 809 42 textmining:809
Rv0181c hyp hypothetical protein 808 41 textmining:808
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 547 41 textmining:547
Rv0654 carotenoid cleavage oxygenase 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215427.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AKTG
  • Curated reference: UniProt O05904 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv0910
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000967|Rv0912|
MTRRLRPGWLVALSAAVIAASTWMPWLTTTVGGGGWVNAIGGTHGSLELPHGFGPGQLIVLLSSTLLVVGAMAGRGLSVKLSSIAALVVSLLIVALTVWYYKLNVNPPVSAEYGLYFGAAGGVCAVGCSLWAAVSAASPGRRRHREVVR