Rv0926c Resolved · high auto-curated

H37Rv Rv0926c · MTBC0 mtbc0_000984 · 358 aa · 1035927–1037003 MTBC0 (-) · RefSeq NP_215441.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationdiacylglycerol kinase
Revised (this work)Diacylglycerol kinase. Pfam: DAP_DH_C (PF19328.5).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.82 (95% CI -0.53 to 3.08). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0949c · 100.0% identity
M. marinum MMAR_4582 · 88.7% identity
M. smegmatis MSMEG_5586 · 75.4% identity
M. orygis RJtmp_000979 · 100.0% identity
M. abscessus MAB_4633 · 66.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6WZS8 TrEMBL · unreviewed · Evidence at protein level
UniProt name2,4-diaminopentanoate dehydrogenase C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiondihydrodipicolinate reductase
Orthologous groupCOG3804
EC number EC 1.4.1.12, EC 1.4.1.26
KEGG orthology K21672
KEGG pathways map00310, map00330, map00472

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.253 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 82.1% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 61.8%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 21 in the ORF — 0 in the essential state, 0 growth-defect, 21 non-essential, 0 growth-advantage. Saturation 0.952, mean read count 83.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance53.7 ppm · rank 1706/3519 (51.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length358 aa
Molecular weight37.8 kDa
Theoretical pI4.64
GRAVY0.235 (hydrophobic)
Aliphatic index102.8
Aromaticity0.059
Instability index37.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DAP_DH_CPF19328.5 6.6e-13145–350 2,4-diaminopentanoate dehydrogenase C-terminal domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.7

PDB hitprobTM-scoreE-valueDescription
6g1m-assembly2_D 1.00 0.85 1.7e-26 sig 6g1m-assembly2_D Amine Dehydrogenase from Petrotoga mobilis; open and closed form
7xdu-assembly1_A 1.00 0.82 2.3e-26 sig 7xdu-assembly1_A TtherAmDH-NAD+
6g1m-assembly2_C 1.00 0.83 6.0e-26 sig 6g1m-assembly2_C Amine Dehydrogenase from Petrotoga mobilis; open and closed form
6g1m-assembly1_B 1.00 0.83 2.3e-25 sig 6g1m-assembly1_B Amine Dehydrogenase from Petrotoga mobilis; open and closed form
6g1h-assembly1_A-2 1.00 0.82 5.3e-25 sig 6g1h-assembly1_A-2 Amine Dehydrogenase from Petrotoga mobilis; open form

Foldseek search of the AlphaFold DB model (mean pLDDT 96.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0925c (- strand, 76 bp gap)
Downstream (3' on genome)Rv0927c (- strand, 53 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0927c (oxidoreductase), high confidence from genomic context alone (score 957 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0927c oxidoreductase 957 957 ctx neighborhood:684 cooccurence:451 coexpression:772
Rv1059 hyp exp hypothetical protein 925 925 database:900
Rv1905c aao exp D-amino acid oxidase 900 900 database:900
Rv0310c hyp hypothetical protein 722 722 ctx cooccurence:722
Rv0311 hyp hypothetical protein 687 688 ctx cooccurence:686
Rv0767c HTH-type transcriptional regulator 644 645 ctx cooccurence:642
Rv0925c hyp hypothetical protein 637 637 ctx neighborhood:613
Rv3541c chsH1 hyp hypothetical protein 634 634 ctx cooccurence:634
Rv3521 hyp hypothetical protein 633 633 ctx cooccurence:633
Rv0762c hyp hypothetical protein 629 630 ctx cooccurence:626
Rv3552 CoA-transferase subunit beta 621 621 ctx cooccurence:620
Rv3529c hyp hypothetical protein 615 615 ctx cooccurence:614
Rv3551 CoA-transferase subunit alpha 598 598 ctx cooccurence:597
Rv3531c hyp hypothetical protein 596 596 ctx cooccurence:596
Rv0924c mntH divalent metal cation transporter MntH 561 561 ctx neighborhood:549

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: diacylglycerol kinase
  • Pfam (hmmscan --cut_ga): DAP_DH_C PF19328.5 (E=7e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215441.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DAP_DH_C (PF19328.5)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3804
  • Curated reference: UniProt I6WZS8 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv0927c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000984|Rv0926c|
MAIPVVQLGTGNVGVHSLRALIADPEFELTGVWVSSDAKAGKDAAELAGLADSTGVRASTDLNAVLATGPRCAVYNAMADNRLPEALEDYRRILAAGINIVGSGPVFLQYPWQVIPDEIIKPLQDAARAGNSSLYVNGIDPGFANDLLPMALAGTCESIEQIRCMEIVDYATYDSAVVMFDVMGFGKPMDQIPMLLQPGVLSLAWGSVVRQLAAGLGISLDGVEEMYVREPAPEAFNIASGHIPKGSAAALRFEVLGLVDGVPAVVLEHVTRLRADLCPEWPQPAQPGGSYRIEISGEPCYAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAAEPGIRTTLDLPLITGEGRYAAA