Rv0926c Resolved · high auto-curated
H37Rv Rv0926c · MTBC0 mtbc0_000984 ·
358 aa · 1035927–1037003 (-) ·
RefSeq NP_215441.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | diacylglycerol kinase |
| Revised (this work) | Diacylglycerol kinase. Pfam: DAP_DH_C (PF19328.5). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6WZS8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 2,4-diaminopentanoate dehydrogenase C-terminal domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | dihydrodipicolinate reductase |
| Orthologous group | COG3804 |
| EC number |
EC 1.4.1.12, EC 1.4.1.26
|
| KEGG orthology |
K21672
|
| KEGG pathways |
map00310, map00330, map00472
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.253 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DAP_DH_C | PF19328.5 | 6.6e-13 | 145–350 | 2,4-diaminopentanoate dehydrogenase C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0927c (oxidoreductase), high confidence from genomic context alone (score 957 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0927c |
oxidoreductase | 957 | 957 ctx | neighborhood:684 cooccurence:451 coexpression:772 |
Rv1059 hyp |
hypothetical protein | 925 | 925 | database:900 |
Rv1905c aao |
D-amino acid oxidase | 900 | 900 | database:900 |
Rv0310c hyp |
hypothetical protein | 722 | 722 ctx | cooccurence:722 |
Rv0311 hyp |
hypothetical protein | 687 | 688 ctx | cooccurence:686 |
Rv0767c |
HTH-type transcriptional regulator | 644 | 645 ctx | cooccurence:642 |
Rv0925c hyp |
hypothetical protein | 637 | 637 ctx | neighborhood:613 |
Rv3541c chsH1 hyp |
hypothetical protein | 634 | 634 ctx | cooccurence:634 |
Rv3521 hyp |
hypothetical protein | 633 | 633 ctx | cooccurence:633 |
Rv0762c hyp |
hypothetical protein | 629 | 630 ctx | cooccurence:626 |
Rv3552 |
CoA-transferase subunit beta | 621 | 621 ctx | cooccurence:620 |
Rv3529c hyp |
hypothetical protein | 615 | 615 ctx | cooccurence:614 |
Rv3551 |
CoA-transferase subunit alpha | 598 | 598 ctx | cooccurence:597 |
Rv3531c hyp |
hypothetical protein | 596 | 596 ctx | cooccurence:596 |
Rv0924c mntH |
divalent metal cation transporter MntH | 561 | 561 ctx | neighborhood:549 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: diacylglycerol kinase
- Pfam (hmmscan --cut_ga): DAP_DH_C PF19328.5 (E=7e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215441.1)
- Domains: Pfam-A via hmmscan --cut_ga — DAP_DH_C (PF19328.5)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3804 - Curated reference: UniProt I6WZS8 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
36 functional partner(s); context anchor
Rv0927c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000984|Rv0926c| MAIPVVQLGTGNVGVHSLRALIADPEFELTGVWVSSDAKAGKDAAELAGLADSTGVRASTDLNAVLATGPRCAVYNAMADNRLPEALEDYRRILAAGINIVGSGPVFLQYPWQVIPDEIIKPLQDAARAGNSSLYVNGIDPGFANDLLPMALAGTCESIEQIRCMEIVDYATYDSAVVMFDVMGFGKPMDQIPMLLQPGVLSLAWGSVVRQLAAGLGISLDGVEEMYVREPAPEAFNIASGHIPKGSAAALRFEVLGLVDGVPAVVLEHVTRLRADLCPEWPQPAQPGGSYRIEISGEPCYAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAAEPGIRTTLDLPLITGEGRYAAA