Rv0926c Resolved · high auto-curated

H37Rv Rv0926c · MTBC0 mtbc0_000984 · 358 aa · 1035927–1037003 (-) · RefSeq NP_215441.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationdiacylglycerol kinase
Revised (this work)Diacylglycerol kinase. Pfam: DAP_DH_C (PF19328.5).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WZS8 TrEMBL · unreviewed · Evidence at protein level
UniProt name2,4-diaminopentanoate dehydrogenase C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiondihydrodipicolinate reductase
Orthologous groupCOG3804
EC number EC 1.4.1.12, EC 1.4.1.26
KEGG orthology K21672
KEGG pathways map00310, map00330, map00472

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.253 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DAP_DH_CPF19328.5 6.6e-13145–350 2,4-diaminopentanoate dehydrogenase C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0927c (oxidoreductase), high confidence from genomic context alone (score 957 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0927c oxidoreductase 957 957 ctx neighborhood:684 cooccurence:451 coexpression:772
Rv1059 hyp hypothetical protein 925 925 database:900
Rv1905c aao D-amino acid oxidase 900 900 database:900
Rv0310c hyp hypothetical protein 722 722 ctx cooccurence:722
Rv0311 hyp hypothetical protein 687 688 ctx cooccurence:686
Rv0767c HTH-type transcriptional regulator 644 645 ctx cooccurence:642
Rv0925c hyp hypothetical protein 637 637 ctx neighborhood:613
Rv3541c chsH1 hyp hypothetical protein 634 634 ctx cooccurence:634
Rv3521 hyp hypothetical protein 633 633 ctx cooccurence:633
Rv0762c hyp hypothetical protein 629 630 ctx cooccurence:626
Rv3552 CoA-transferase subunit beta 621 621 ctx cooccurence:620
Rv3529c hyp hypothetical protein 615 615 ctx cooccurence:614
Rv3551 CoA-transferase subunit alpha 598 598 ctx cooccurence:597
Rv3531c hyp hypothetical protein 596 596 ctx cooccurence:596
Rv0924c mntH divalent metal cation transporter MntH 561 561 ctx neighborhood:549

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: diacylglycerol kinase
  • Pfam (hmmscan --cut_ga): DAP_DH_C PF19328.5 (E=7e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215441.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DAP_DH_C (PF19328.5)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3804
  • Curated reference: UniProt I6WZS8 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv0927c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000984|Rv0926c|
MAIPVVQLGTGNVGVHSLRALIADPEFELTGVWVSSDAKAGKDAAELAGLADSTGVRASTDLNAVLATGPRCAVYNAMADNRLPEALEDYRRILAAGINIVGSGPVFLQYPWQVIPDEIIKPLQDAARAGNSSLYVNGIDPGFANDLLPMALAGTCESIEQIRCMEIVDYATYDSAVVMFDVMGFGKPMDQIPMLLQPGVLSLAWGSVVRQLAAGLGISLDGVEEMYVREPAPEAFNIASGHIPKGSAAALRFEVLGLVDGVPAVVLEHVTRLRADLCPEWPQPAQPGGSYRIEISGEPCYAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAAEPGIRTTLDLPLITGEGRYAAA