Rv2775 Resolved · high auto-curated

H37Rv Rv2775 · MTBC0 - · 153 aa · 3082909–3083370 (+) · RefSeq NP_217291.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GCN5-like N-acetyltransferase
MTBC0 PGAP re-annotation
Revised (this work)GCN5-like N-acetyltransferase. Pfam: Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O33317 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable N-acetyltransferase Rv2775
EC (curated) EC 2.3.1.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionAcetyltransferase (GNAT) domain
Orthologous groupCOG0454

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_10PF13673.14 8.6e-1030–129 Acetyltransferase (GNAT) domain
Acetyltransf_1PF00583.32 1.2e-1334–120 Acetyltransferase (GNAT) family
Acetyltransf_7PF13508.14 1.7e-1243–123 Acetyltransferase (GNAT) domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2209 (integral membrane protein), high confidence from genomic context alone (score 703 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2209 integral membrane protein 705 703 ctx cooccurence:702
Rv0355c PPE8 PPE family protein PPE8 697 698 ctx cooccurence:696
Rv3350c PPE56 PPE family protein PPE56 696 697 ctx cooccurence:696
Rv1004c membrane protein 695 695 ctx cooccurence:686
Rv3347c PPE55 PPE family protein PPE55 691 692 ctx cooccurence:691
Rv0330c hyp hypothetical protein 689 689 ctx cooccurence:689
Rv0341 iniB isoniazid inducible protein IniB 682 682 ctx cooccurence:682
Rv3343c PPE54 PPE family protein PPE54 678 678 ctx cooccurence:677
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 678 678 ctx cooccurence:675
Rv2954c hyp hypothetical protein 679 677 ctx cooccurence:621
Rv0304c PPE5 PPE family protein PPE5 671 671 ctx cooccurence:670
Rv1917c PPE34 PPE family protein PPE34 668 668 ctx cooccurence:668
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 655 655 ctx cooccurence:652
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 654 654 ctx cooccurence:651
Rv2082 hyp hypothetical protein 639 639 ctx cooccurence:636

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): GCN5-like N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_10 PF13673.14 (E=9e-10), Acetyltransf_1 PF00583.32 (E=1e-13), Acetyltransf_7 PF13508.14 (E=2e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217291.3)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0454
  • Curated reference: UniProt O33317 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s); context anchor Rv2209
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2775|
MHYPVWRQSWTGILDPYLLDMIGSPKLWVEESYPQSLKRGGWSMWIAESGGQPIGMTMFGPDIAHPDRIQIDALYVAENSQRHGIGGRLLNRALHSHPSADMILWCAEKNSKARGFYEKKDFHIDGRTFTWKPLSGVNVPHVGYRLYRSAPPG