Rv2775 Resolved · high auto-curated
H37Rv Rv2775 · MTBC0 - ·
153 aa · 3082909–3083370 (+) ·
RefSeq NP_217291.3
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | GCN5-like N-acetyltransferase. Pfam: Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O33317
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable N-acetyltransferase Rv2775 |
| EC (curated) |
EC 2.3.1.-
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Acetyltransferase (GNAT) domain |
| Orthologous group | COG0454 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_10 | PF13673.14 | 8.6e-10 | 30–129 | Acetyltransferase (GNAT) domain |
Acetyltransf_1 | PF00583.32 | 1.2e-13 | 34–120 | Acetyltransferase (GNAT) family |
Acetyltransf_7 | PF13508.14 | 1.7e-12 | 43–123 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2209 (integral membrane protein), high confidence from genomic context alone (score 703 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2209 |
integral membrane protein | 705 | 703 ctx | cooccurence:702 |
Rv0355c PPE8 |
PPE family protein PPE8 | 697 | 698 ctx | cooccurence:696 |
Rv3350c PPE56 |
PPE family protein PPE56 | 696 | 697 ctx | cooccurence:696 |
Rv1004c |
membrane protein | 695 | 695 ctx | cooccurence:686 |
Rv3347c PPE55 |
PPE family protein PPE55 | 691 | 692 ctx | cooccurence:691 |
Rv0330c hyp |
hypothetical protein | 689 | 689 ctx | cooccurence:689 |
Rv0341 iniB |
isoniazid inducible protein IniB | 682 | 682 ctx | cooccurence:682 |
Rv3343c PPE54 |
PPE family protein PPE54 | 678 | 678 ctx | cooccurence:677 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 678 | 678 ctx | cooccurence:675 |
Rv2954c hyp |
hypothetical protein | 679 | 677 ctx | cooccurence:621 |
Rv0304c PPE5 |
PPE family protein PPE5 | 671 | 671 ctx | cooccurence:670 |
Rv1917c PPE34 |
PPE family protein PPE34 | 668 | 668 ctx | cooccurence:668 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 655 | 655 ctx | cooccurence:652 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 654 | 654 ctx | cooccurence:651 |
Rv2082 hyp |
hypothetical protein | 639 | 639 ctx | cooccurence:636 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): GCN5-like N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_10 PF13673.14 (E=9e-10), Acetyltransf_1 PF00583.32 (E=1e-13), Acetyltransf_7 PF13508.14 (E=2e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217291.3)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_10 (PF13673.14), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt O33317 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
70 functional partner(s); context anchor
Rv2209 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2775| MHYPVWRQSWTGILDPYLLDMIGSPKLWVEESYPQSLKRGGWSMWIAESGGQPIGMTMFGPDIAHPDRIQIDALYVAENSQRHGIGGRLLNRALHSHPSADMILWCAEKNSKARGFYEKKDFHIDGRTFTWKPLSGVNVPHVGYRLYRSAPPG