Rv2170 Resolved · high auto-curated

H37Rv Rv2170 · MTBC0 mtbc0_002304 · 206 aa · 2458242–2458862 MTBC0 (+) · RefSeq NP_216686.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand murE (Rv2158c) — requalified: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2%2C6-diaminopime murE Rv2159c (Rv2159c) — family_assigned: carboxymuconolactone decarboxylase family protein Rv2159c Rv2161c (Rv2161c) — family_assigned: TIGR03619 family F420-dependent LLM class oxidoreductase Rv2161c pbpB (Rv2163c) — requalified: D%2CD-transpeptidase PbpB pbpB Rv2164c (Rv2164c) — family_assigned: hypothetical protein Rv2164c rsmH (Rv2165c) — requalified: 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH rsmH mraZ (Rv2166c) — requalified: division/cell wall cluster transcriptional repressor MraZ Rv2169c (Rv2169c) — dark: DUF3040 domain-containing protein Rv2170 (Rv2170) — requalified: N-acetyltransferase lppM (Rv2171) — requalified: lipoprotein LppM Rv2172c (Rv2172c) — requalified: mycobacterial-type methylenetetrahydrofolate reductase Rv2172c idsA2 (Rv2173) — requalified: bifunctional (2E%2C6E)-farnesyl/geranyl diphosphate synthase idsA2 mptA (Rv2174) — requalified: alpha-(1->6)-mannopyranosyltransferase A mptA pknL (Rv2176) — requalified: protein kinase pknL aroG (Rv2178c) — requalified: 3-deoxy-7-phosphoheptulonate synthase class II aroG Rv2179c (Rv2179c) — requalified: polyadenylate-specific 3'-exoribonuclease AS Rv2180c (Rv2180c) — family_assigned: integral membrane protein Rv2180c Rv2181 (Rv2181) — requalified: alpha-(1-2)-phosphatidylinositol mannoside mannosyltransfera Rv2181 2 448 kb 2 452 kb 2 456 kb 2 460 kb 2 464 kb 2 468 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GCN5-like N-acetyltransferase
MTBC0 PGAP re-annotationN-acetyltransferase
Revised (this work)N-acetyltransferase. Pfam: FR47 (PF08445.17), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
Acetylation of Isoniazid Is a Novel Mechanism of Isoniazid Resistance in Mycobacterium tuberculosis. doi:10.1128/AAC.00456-20 2020
Novel protein acetyltransferase, Rv2170, modulates carbon and energy metabolism in Mycobacterium tuberculosis. doi:10.1038/s41598-017-00067-1 2017

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.76 (95% CI -0.80 to 3.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionAcetylation, substrate unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2192 · 99.5% identity
M. leprae ML0903c · 77.1% identity
M. marinum MMAR_3205 · 75.5% identity
M. smegmatis MSMEG_4238 · 72.3% identity
M. orygis RJtmp_002239 · 99.5% identity
M. abscessus MAB_1995c · 61.1% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53504 SwissProt · reviewed · Evidence at protein level
UniProt nameGCN5-like protein acetyltransferase Rv2170
EC (curated) EC 2.3.1.-
Curated functionAcetyltransferase involved in the post-translational regulation of the central metabolic enzyme isocitrate dehydrogenase 1 (ICDH-1) through lysine acetylation. Catalyzes the acetylation of ICDH-1 at Lys-30 and Lys-129, using acetyl-CoA as a donor, leading to a reduction of ICDH-1 enzyme activity. Can also use propionyl-CoA and succinyl-CoA as donors. Cannot act on the isocitrate dehydrogenase 2 (ICDH-2). Might play a role in regulating the TCA cycle and methylcitrate cycle when M.tuberculosis utilizes fatty acid as carbon source..; FUNCTION: In addition, it can acetylate the amino group of iso.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionAcetyltransferase (GNAT) family
Orthologous groupCOG0454

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.281 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 78.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 47.7%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 87.5333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection, day 45 (in vivo) -4.160.002 required
altered fitness under Rifampicin (drug exposure) -2.860.0 required
altered fitness under 6 weeks hypoxia (stress) -2.840.0 required
fitness in mouse infection (in vivo) +1.800.021 disruption advantageous
Mutants exhibiting altered fitness in the absence of gene marP (other) -1.510.02 required

Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance11.8 ppm · rank 2607/3519 (25.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length206 aa
Molecular weight22.9 kDa
Theoretical pI6.85
GRAVY-0.172 (hydrophilic)
Aliphatic index92.5
Aromaticity0.087
Instability index42.2 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FR47PF08445.17 9.1e-07104–184 FR47-like protein
Acetyltransf_1PF00583.32 4.3e-05124–181 Acetyltransferase (GNAT) family
Acetyltransf_7PF13508.14 2.9e-06125–182 Acetyltransferase (GNAT) domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.2

PDB hitprobTM-scoreE-valueDescription
1tiq-assembly1_A 1.00 0.73 6.9e-10 sig 1tiq-assembly1_A Crystal Structure of an Acetyltransferase (PaiA) in complex with CoA and DTT from Bacillus subtilis, Northeast Structural Genomics Target SR64.
2r7h-assembly1_B 1.00 0.76 4.3e-08 sig 2r7h-assembly1_B CRYSTAL STRUCTURE OF A putative acetyltransferase of the GNAT family (DDE_3044) FROM DESULFOVIBRIO DESULFURICANS SUBSP. AT 1.85 A RESOLUTION
1tiq-assembly2_B 1.00 0.70 3.8e-08 sig 1tiq-assembly2_B Crystal Structure of an Acetyltransferase (PaiA) in complex with CoA and DTT from Bacillus subtilis, Northeast Structural Genomics Target SR64.
4e2a-assembly1_A 1.00 0.67 1.4e-08 sig 4e2a-assembly1_A Crystal Structure of the Putative acetyltransferase from Streptococcus mutans
2cnt-assembly4_D 1.00 0.77 2.4e-06 sig 2cnt-assembly4_D RimI - Ribosomal S18 N-alpha-protein acetyltransferase in complex with CoenzymeA.

Foldseek search of the AlphaFold DB model (mean pLDDT 93.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv2169c (- strand, 265 bp gap)
Downstream (3' on genome)lppM (+ strand, 95 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2169c (transmembrane protein), high confidence from genomic context alone (score 776 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2169c transmembrane protein 776 776 ctx neighborhood:733
Rv2171 lppM lipoprotein LppM 775 776 ctx neighborhood:775
Rv3231c hyp hypothetical protein 770 771 ctx cooccurence:770
Rv3311 hyp hypothetical protein 763 763 ctx cooccurence:763
Rv2520c membrane protein 740 741 ctx cooccurence:740
Rv3212 hyp hypothetical protein 736 737 ctx cooccurence:735
Rv3605c hyp hypothetical protein 722 722 ctx cooccurence:722
Rv2179c 3'-5' exoribonuclease 715 716 ctx cooccurence:714
Rv3438 hyp hypothetical protein 712 712 ctx cooccurence:711
Rv1209 hyp hypothetical protein 700 700 ctx cooccurence:700
Rv2446c integral membrane protein 699 700 ctx cooccurence:699
Rv2980 hyp hypothetical protein 697 697 ctx cooccurence:697
Rv0948c chorismate mutase 695 695 ctx cooccurence:692
Rv3412 hyp hypothetical protein 686 686 ctx cooccurence:686
Rv2219 transmembrane protein 682 683 ctx cooccurence:681

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GCN5-like N-acetyltransferase
  • MTBC0 PGAP product: N-acetyltransferase
  • Pfam (hmmscan --cut_ga): FR47 PF08445.17 (E=9e-07), Acetyltransf_1 PF00583.32 (E=4e-05), Acetyltransf_7 PF13508.14 (E=3e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216686.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FR47 (PF08445.17), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0454
  • Curated reference: UniProt O53504 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 80 functional partner(s); context anchor Rv2169c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002304|Rv2170|
MAIFLIDLPPSDMERRLGDALTVYVDAMRYPRGTETLRAPMWLEHIRRRGWQAVAAVEVTAAEQAEAADTTALPSAAELSNAPMLGVAYGYPGAPGQWWQQQVVLGLQRSGFPRLAIARLMTSYFELTELHILPRAQGRGLGEALARRLLAGRDEDNVLLSTPETNGEDNRAWRLYRRLGFTDIIRGYHFAGDPRAFAILGRTLPL