Rv2170 Resolved · high auto-curated
H37Rv Rv2170 · MTBC0 mtbc0_002304 ·
206 aa · 2458242–2458862 (+) ·
RefSeq NP_216686.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | N-acetyltransferase |
| Revised (this work) | N-acetyltransferase. Pfam: FR47 (PF08445.17), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53504
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | GCN5-like protein acetyltransferase Rv2170 |
| EC (curated) |
EC 2.3.1.-
|
| Curated function | Acetyltransferase involved in the post-translational regulation of the central metabolic enzyme isocitrate dehydrogenase 1 (ICDH-1) through lysine acetylation. Catalyzes the acetylation of ICDH-1 at Lys-30 and Lys-129, using acetyl-CoA as a donor, leading to a reduction of ICDH-1 enzyme activity. Can also use propionyl-CoA and succinyl-CoA as donors. Cannot act on the isocitrate dehydrogenase 2 (ICDH-2). Might play a role in regulating the TCA cycle and methylcitrate cycle when M.tuberculosis utilizes fatty acid as carbon source..; FUNCTION: In addition, it can acetylate the amino group of iso. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Acetyltransferase (GNAT) family |
| Orthologous group | COG0454 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.281 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FR47 | PF08445.17 | 9.1e-07 | 104–184 | FR47-like protein |
Acetyltransf_1 | PF00583.32 | 4.3e-05 | 124–181 | Acetyltransferase (GNAT) family |
Acetyltransf_7 | PF13508.14 | 2.9e-06 | 125–182 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2169c (transmembrane protein), high confidence from genomic context alone (score 776 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2169c |
transmembrane protein | 776 | 776 ctx | neighborhood:733 |
Rv2171 lppM |
lipoprotein LppM | 775 | 776 ctx | neighborhood:775 |
Rv3231c hyp |
hypothetical protein | 770 | 771 ctx | cooccurence:770 |
Rv3311 hyp |
hypothetical protein | 763 | 763 ctx | cooccurence:763 |
Rv2520c |
membrane protein | 740 | 741 ctx | cooccurence:740 |
Rv3212 hyp |
hypothetical protein | 736 | 737 ctx | cooccurence:735 |
Rv3605c hyp |
hypothetical protein | 722 | 722 ctx | cooccurence:722 |
Rv2179c |
3'-5' exoribonuclease | 715 | 716 ctx | cooccurence:714 |
Rv3438 hyp |
hypothetical protein | 712 | 712 ctx | cooccurence:711 |
Rv1209 hyp |
hypothetical protein | 700 | 700 ctx | cooccurence:700 |
Rv2446c |
integral membrane protein | 699 | 700 ctx | cooccurence:699 |
Rv2980 hyp |
hypothetical protein | 697 | 697 ctx | cooccurence:697 |
Rv0948c |
chorismate mutase | 695 | 695 ctx | cooccurence:692 |
Rv3412 hyp |
hypothetical protein | 686 | 686 ctx | cooccurence:686 |
Rv2219 |
transmembrane protein | 682 | 683 ctx | cooccurence:681 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: N-acetyltransferase
- Pfam (hmmscan --cut_ga): FR47 PF08445.17 (E=9e-07), Acetyltransf_1 PF00583.32 (E=4e-05), Acetyltransf_7 PF13508.14 (E=3e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216686.1)
- Domains: Pfam-A via hmmscan --cut_ga — FR47 (PF08445.17), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt O53504 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
80 functional partner(s); context anchor
Rv2169c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002304|Rv2170| MAIFLIDLPPSDMERRLGDALTVYVDAMRYPRGTETLRAPMWLEHIRRRGWQAVAAVEVTAAEQAEAADTTALPSAAELSNAPMLGVAYGYPGAPGQWWQQQVVLGLQRSGFPRLAIARLMTSYFELTELHILPRAQGRGLGEALARRLLAGRDEDNVLLSTPETNGEDNRAWRLYRRLGFTDIIRGYHFAGDPRAFAILGRTLPL