Rv2170 Resolved · high auto-curated
H37Rv Rv2170 · MTBC0 mtbc0_002304 ·
206 aa ·
2458242–2458862 MTBC0
(+) ·
RefSeq NP_216686.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | GCN5-like N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | N-acetyltransferase |
| Revised (this work) | N-acetyltransferase. Pfam: FR47 (PF08445.17), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Acetylation of Isoniazid Is a Novel Mechanism of Isoniazid Resistance in Mycobacterium tuberculosis. doi:10.1128/AAC.00456-20 | 2020 |
| Novel protein acetyltransferase, Rv2170, modulates carbon and energy metabolism in Mycobacterium tuberculosis. doi:10.1038/s41598-017-00067-1 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.76 (95% CI -0.80 to 3.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Acetylation, substrate unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2192
· 99.5% identity |
|---|---|
| M. leprae |
ML0903c
· 77.1% identity |
| M. marinum |
MMAR_3205
· 75.5% identity |
| M. smegmatis |
MSMEG_4238
· 72.3% identity |
| M. orygis |
RJtmp_002239
· 99.5% identity |
| M. abscessus |
MAB_1995c
· 61.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53504
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | GCN5-like protein acetyltransferase Rv2170 |
| EC (curated) |
EC 2.3.1.-
|
| Curated function | Acetyltransferase involved in the post-translational regulation of the central metabolic enzyme isocitrate dehydrogenase 1 (ICDH-1) through lysine acetylation. Catalyzes the acetylation of ICDH-1 at Lys-30 and Lys-129, using acetyl-CoA as a donor, leading to a reduction of ICDH-1 enzyme activity. Can also use propionyl-CoA and succinyl-CoA as donors. Cannot act on the isocitrate dehydrogenase 2 (ICDH-2). Might play a role in regulating the TCA cycle and methylcitrate cycle when M.tuberculosis utilizes fatty acid as carbon source..; FUNCTION: In addition, it can acetylate the amino group of iso. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Acetyltransferase (GNAT) family |
| Orthologous group | COG0454 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.281 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 47.7% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 87.5333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 45 (in vivo) | -4.16 | 0.002 | required |
| altered fitness under Rifampicin (drug exposure) | -2.86 | 0.0 | required |
| altered fitness under 6 weeks hypoxia (stress) | -2.84 | 0.0 | required |
| fitness in mouse infection (in vivo) | +1.80 | 0.021 | disruption advantageous |
| Mutants exhibiting altered fitness in the absence of gene marP (other) | -1.51 | 0.02 | required |
Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 11.8 ppm · rank 2607/3519 (25.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 206 aa |
|---|---|
| Molecular weight | 22.9 kDa |
| Theoretical pI | 6.85 |
| GRAVY | -0.172 (hydrophilic) |
| Aliphatic index | 92.5 |
| Aromaticity | 0.087 |
| Instability index | 42.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FR47 | PF08445.17 | 9.1e-07 | 104–184 | FR47-like protein |
Acetyltransf_1 | PF00583.32 | 4.3e-05 | 124–181 | Acetyltransferase (GNAT) family |
Acetyltransf_7 | PF13508.14 | 2.9e-06 | 125–182 | Acetyltransferase (GNAT) domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1tiq-assembly1_A |
1.00 | 0.73 | 6.9e-10 sig | 1tiq-assembly1_A Crystal Structure of an Acetyltransferase (PaiA) in complex with CoA and DTT from Bacillus subtilis, Northeast Structural Genomics Target SR64. |
2r7h-assembly1_B |
1.00 | 0.76 | 4.3e-08 sig | 2r7h-assembly1_B CRYSTAL STRUCTURE OF A putative acetyltransferase of the GNAT family (DDE_3044) FROM DESULFOVIBRIO DESULFURICANS SUBSP. AT 1.85 A RESOLUTION |
1tiq-assembly2_B |
1.00 | 0.70 | 3.8e-08 sig | 1tiq-assembly2_B Crystal Structure of an Acetyltransferase (PaiA) in complex with CoA and DTT from Bacillus subtilis, Northeast Structural Genomics Target SR64. |
4e2a-assembly1_A |
1.00 | 0.67 | 1.4e-08 sig | 4e2a-assembly1_A Crystal Structure of the Putative acetyltransferase from Streptococcus mutans |
2cnt-assembly4_D |
1.00 | 0.77 | 2.4e-06 sig | 2cnt-assembly4_D RimI - Ribosomal S18 N-alpha-protein acetyltransferase in complex with CoenzymeA. |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2169c (- strand, 265 bp gap) |
|---|---|
| Downstream (3' on genome) | lppM (+ strand, 95 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2169c (transmembrane protein), high confidence from genomic context alone (score 776 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2169c |
transmembrane protein | 776 | 776 ctx | neighborhood:733 |
Rv2171 lppM |
lipoprotein LppM | 775 | 776 ctx | neighborhood:775 |
Rv3231c hyp |
hypothetical protein | 770 | 771 ctx | cooccurence:770 |
Rv3311 hyp |
hypothetical protein | 763 | 763 ctx | cooccurence:763 |
Rv2520c |
membrane protein | 740 | 741 ctx | cooccurence:740 |
Rv3212 hyp |
hypothetical protein | 736 | 737 ctx | cooccurence:735 |
Rv3605c hyp |
hypothetical protein | 722 | 722 ctx | cooccurence:722 |
Rv2179c |
3'-5' exoribonuclease | 715 | 716 ctx | cooccurence:714 |
Rv3438 hyp |
hypothetical protein | 712 | 712 ctx | cooccurence:711 |
Rv1209 hyp |
hypothetical protein | 700 | 700 ctx | cooccurence:700 |
Rv2446c |
integral membrane protein | 699 | 700 ctx | cooccurence:699 |
Rv2980 hyp |
hypothetical protein | 697 | 697 ctx | cooccurence:697 |
Rv0948c |
chorismate mutase | 695 | 695 ctx | cooccurence:692 |
Rv3412 hyp |
hypothetical protein | 686 | 686 ctx | cooccurence:686 |
Rv2219 |
transmembrane protein | 682 | 683 ctx | cooccurence:681 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: GCN5-like N-acetyltransferase
- MTBC0 PGAP product: N-acetyltransferase
- Pfam (hmmscan --cut_ga): FR47 PF08445.17 (E=9e-07), Acetyltransf_1 PF00583.32 (E=4e-05), Acetyltransf_7 PF13508.14 (E=3e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216686.1)
- Domains: Pfam-A via hmmscan --cut_ga — FR47 (PF08445.17), Acetyltransf_1 (PF00583.32), Acetyltransf_7 (PF13508.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt O53504 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
80 functional partner(s); context anchor
Rv2169c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002304|Rv2170| MAIFLIDLPPSDMERRLGDALTVYVDAMRYPRGTETLRAPMWLEHIRRRGWQAVAAVEVTAAEQAEAADTTALPSAAELSNAPMLGVAYGYPGAPGQWWQQQVVLGLQRSGFPRLAIARLMTSYFELTELHILPRAQGRGLGEALARRLLAGRDEDNVLLSTPETNGEDNRAWRLYRRLGFTDIIRGYHFAGDPRAFAILGRTLPL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2170? Email the maintainer — the message is pre-filled with this gene's details.