betP Family assigned · medium auto-curated

H37Rv Rv0917 · MTBC0 mtbc0_000973 · 593 aa · 1025302–1027083 (+) · RefSeq NP_215432.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycine betaine transport integral membrane protein BetP
MTBC0 PGAP re-annotationBCCT family transporter
Revised (this work)BCCT family transporter. Pfam: BCCT (PF02028.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPR7 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized transporter Rv0917

UniProt still lists this protein as Uncharacterized transporter Rv0917; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
Preferred namebetP
eggNOG descriptionBelongs to the BCCT transporter (TC 2.A.15) family
Orthologous groupCOG1292
KEGG orthology K02168
Gene Ontology (12) GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006810, GO:0008150, GO:0016020, GO:0044464, GO:0051179, GO:0051234, GO:0071705, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.594 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BCCTPF02028.25 1.1e-18423–509 BCCT, betaine/carnitine/choline family transporter

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0919 GCN5-like N-acetyltransferase 419 397
Rv0985c mscL large-conductance ion mechanosensitive channel 491 93 textmining:462
Rv1731 gabD2 succinate-semialdehyde dehydrogenase 706 78 textmining:695
Rv0001 dnaA chromosomal replication initiator protein DnaA 527 67 textmining:514
Rv3772 hisC2 histidinol-phosphate aminotransferase 872 63 textmining:870
Rv1435c hyp hypothetical protein 872 61 textmining:870
Rv1726 oxidoreductase 872 58 textmining:870
Rv1683 bifunctional long-chain acyl-CoA synthase/lipase 779 53 textmining:777
Rv2749 hyp hypothetical protein 871 49 textmining:870
Rv1403c methyltransferase 809 46 textmining:809
Rv0059 darT hyp hypothetical protein 653 46 textmining:652
Rv1704c cycA D-serine/alanine/glycine transporter protein CycA 513 46 textmining:511
Rv3331 sugI sugar-transport integral membrane protein SugI 812 44 textmining:812
Rv3859c gltB glutamate synthase large subunit 423 44 textmining:422
Rv0759c hyp hypothetical protein 806 42 textmining:806

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glycine betaine transport integral membrane protein BetP
  • MTBC0 PGAP product: BCCT family transporter
  • Pfam (hmmscan --cut_ga): BCCT PF02028.25 (E=1e-184)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215432.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BCCT (PF02028.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1292
  • Curated reference: UniProt P9WPR7 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000973|Rv0917|betP
MSAKERGDQNAVVDALRSIQPAVFIPASVVIVAMIVVSVVYSSVAENAFVRLNSAITGGVGWWYILVATGFVVFALYCGISRIGTIRLGRDDELPEFSFWAWLAMLFSAGMGIGLVFYGVAEPLSHYLRPPRSRGVPALTDAAANQAMALTVFHWGLHAWAIYVVVGLGMAYMTYRRGRPLSVRWLLEPVVGRGRVEGALGHAVDVIAIVGTLFGVATSLGFGITQIASGLEYLGWIRVDNWWMVGMIAAITATATASVVSGVSKGLKWLSNINMALAAALALFVLLLGPTLFLLQSWVQNLGGYVQSLPQFMLRTAPFSHDGWLGDWTIFYWGWWISWAPFVGMFIARISRGRTIREFIGAVLLVPTVIASLWFTIFGDSALLRQRNNGDMLVNGAVDTNTSLFRLLDGLPIGAITSVLAVLVIVFFFVTSSDSGSLVIDILSAGGELDPPKLTRVYWAVLEGVAAAVLLLIGGAGSLTALRTAAIATALPFSIVMVVACYAMTKAFHFDLAATPRLLHVTVPDVVAAGNRRRHDISATLSGLIAVRDVDSGTYIVHPDTGALTVTAPPDPLDDHVFESDRHVTRRNTTSSR