Rv0909 Resolved · high auto-curated

H37Rv Rv0909 · MTBC0 mtbc0_000964 · 59 aa · 1017896–1018075 (+) · RefSeq NP_215424.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin
MTBC0 PGAP re-annotationantitoxin
Revised (this work)Antitoxin. Pfam: MT0933_antitox (PF14013.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ07 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin Rv0909
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin Rv0910.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionMT0933-like antitoxin protein
Orthologous group2EJAX
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 1.08% of strains (1571) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MT0933_antitoxPF14013.12 1.7e-194–50 MT0933-like antitoxin protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0910 (toxin), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0910 toxin 978 887 ctx neighborhood:882 textmining:814
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 733 733 coexpression:733
Rv0911 hyp hypothetical protein 619 620 ctx neighborhood:604
Rv0906 hyp hypothetical protein 582 583 ctx neighborhood:544
Rv0908 ctpE metal cation transporter ATPase E 576 576 ctx neighborhood:544
Rv0907 hyp hypothetical protein 546 546 ctx neighborhood:544
Rv0905 echA6 enoyl-CoA hydratase EchA6 545 545 ctx neighborhood:544
Rv0273c transcriptional regulator 533 533 coexpression:533
Rv2418c octT hyp hypothetical protein 500 476 experimental:425
Rv1075c hyp hypothetical protein 498 474 experimental:425
Rv1740 vapB34 antitoxin VapB34 474 474 coexpression:474
Rv0518 hyp hypothetical protein 494 470 experimental:425
Rv0912 transmembrane protein 445 445 ctx neighborhood:442
Rv1975 hyp hypothetical protein 440 440 coexpression:430
Rv0157A hyp hypothetical protein 438 438 coexpression:428

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin
  • MTBC0 PGAP product: antitoxin
  • Pfam (hmmscan --cut_ga): MT0933_antitox PF14013.12 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215424.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MT0933_antitox (PF14013.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EJAX
  • Curated reference: UniProt P9WJ07 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor Rv0910
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000964|Rv0909|
MGILDKVKNLLSQNADKVETVINKAGEFVDEQTQGNYSDAIHKLQDAASNVVGMSDQQS