Rv0923c Family assigned · medium auto-curated

H37Rv Rv0923c · MTBC0 mtbc0_000981 · 354 aa · 1032730–1033794 (-) · RefSeq NP_215438.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationpoly-gamma-glutamate hydrolase family protein
Revised (this work)Poly-gamma-glutamate hydrolase family protein. Pfam: GGACT (PF06094.18), AIG2_2 (PF13772.12), Gamma_PGA_hydro (PF05908.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XWK6 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhage-related replication protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionReplication protein
Orthologous groupCOG2105

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.928 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GGACTPF06094.18 1.1e-128–104 Gamma-glutamyl cyclotransferase, AIG2-like
AIG2_2PF13772.12 5.5e-1457–137 AIG2-like family
Gamma_PGA_hydroPF05908.17 2.1e-37170–322 Poly-gamma-glutamate hydrolase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mntH (divalent metal cation transporter MntH), high confidence from genomic context alone (score 887 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0924c mntH divalent metal cation transporter MntH 887 887 ctx neighborhood:882
Rv0925c hyp hypothetical protein 710 710 ctx neighborhood:708
Rv2079 hyp hypothetical protein 608 609 ctx cooccurence:605
Rv2423 hyp hypothetical protein 596 596 ctx cooccurence:596
Rv1347c mbtK lysine N-acetyltransferase MbtK 575 575 ctx cooccurence:575
Rv3899c hyp hypothetical protein 565 565 ctx cooccurence:560
Rv3887c eccD2 ESX-2 secretion system protein EccD 554 554 ctx cooccurence:554
Rv1904 hyp hypothetical protein 543 543 ctx cooccurence:542
Rv0926c hyp hypothetical protein 516 517 ctx neighborhood:514
Rv1795 eccD5 ESX-5 type VII secretion system protein EccD 503 504 ctx cooccurence:496
Rv1796 mycP5 membrane-anchored mycosin MycP 493 494 ctx cooccurence:491
Rv3895c eccB2 ESX-2 secretion system protein EccB 493 494 ctx cooccurence:488
Rv2067c hyp hypothetical protein 478 479 ctx cooccurence:476
Rv0875c hyp hypothetical protein 463 463 ctx cooccurence:458
Rv0497 transmembrane protein 434 434 ctx cooccurence:426

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: poly-gamma-glutamate hydrolase family protein
  • Pfam (hmmscan --cut_ga): GGACT PF06094.18 (E=1e-12), AIG2_2 PF13772.12 (E=5e-14), Gamma_PGA_hydro PF05908.17 (E=2e-37)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215438.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GGACT (PF06094.18), AIG2_2 (PF13772.12), Gamma_PGA_hydro (PF05908.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2105
  • Curated reference: UniProt I6XWK6 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor mntH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000981|Rv0923c|
MPDRRHPYFAYGSNLCAHQMASRCPDAGAPRPAVLSDHNWLINQRGVATVEPFAGNKVHGVLWQLSERDLVRLDSAEGVPVRYRRERLTVHTDDTALPAWVYIDHRVMPGRPRPGYLPRVIDGARHHGLPQRWIDYLHRWDPARWPLPVLPSSRSGPAPQSLSELLSQPGVIETSQLRSRFGFLAIHGGGLEQVTDLIAERSAEAAGASVYLLRHPDNYPHHLPSARFDPAESARLAEFLDHVDVAVSLHGYDRIGRSTQLLAGGRNRALAAHLARHIQLPGYRVVTDLAAIPEELRGLHPDNPVNRVRDGGTQLELSIRVRGLGPRSTLPGVGGMSPVTATLVQGLVTAARSW