Rv2949c Family assigned · medium auto-curated
H37Rv Rv2949c · MTBC0 mtbc0_003131 ·
199 aa ·
3321146–3321745 MTBC0
(-) ·
RefSeq NP_217465.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | chorismate pyruvate-lyase |
|---|---|
| MTBC0 PGAP re-annotation | chorismate pyruvate-lyase family protein |
| Revised (this work) | Chorismate pyruvate-lyase family protein. Pfam: Rv2949c-like (PF01947.22). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Revisiting the expression signature of pks15/1 unveils regulatory patterns controlling phenolphtiocerol and phenolglycolipid production in pathogenic mycobacteria. doi:10.1371/journal.pone.0229700 | 2020 |
| p-Hydroxybenzoic acid synthesis in Mycobacterium tuberculosis. doi:10.1074/jbc.M508332200 | 2005 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Lsr2 (lsr2).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.65 (95% CI -0.42 to 5.05). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Catalyzes the conversion of chorismate to 4-hydroxybenzoate [catalytic activity: chorismate = 4-hydroxybenzoate + pyruvate] |
|---|---|
| Mycobrowser EC |
4.1.3.-
· superseded EC numbering; the atlas uses the current class (4.1.3.40)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2973c
· 100.0% identity |
|---|---|
| M. leprae |
ML0133
· 62.6% identity |
| M. marinum |
MMAR_1760
· 59.9% identity |
| M. orygis |
RJtmp_003040
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIC5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Chorismate pyruvate-lyase |
| EC (curated) |
EC 4.1.3.40
|
| Curated function | Removes the pyruvyl group from chorismate to provide 4-hydroxybenzoate (4HB). Involved in the synthesis of glycosylated p-hydroxybenzoic acid methyl esters (p-HBADs) and phenolic glycolipids (PGL) that play important roles in the pathogenesis of mycobacterial infections. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| eggNOG description | Responsible for the direct conversion of chorismate to p-hydroxybenzoate, the substrate used in the production of glycosylated p-hydroxybenzoic acid methyl esters and structurally related phenolphthiocerol glycolipids. in M. tuberculosis, this is the sole enzymatic source of p- hydroxybenzoic acid |
| Orthologous group | COG3161 |
| EC number |
EC 4.1.3.40
|
| KEGG orthology |
K03181
|
| KEGG pathways |
map00130, map01100, map01110
|
| KEGG modules |
M00117
|
| Gene Ontology (34) |
GO:0003674, GO:0003824, GO:0006082, GO:0008150, GO:0008152, GO:0008813, GO:0009058, GO:0009273, GO:0009987, GO:0016043, GO:0016053, GO:0016829 +22 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.855 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 7 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (290) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 18/53 (34%) · mean identity 61.4%
· 4/4 closest MTBAP relatives present in a subset of the genus (18/53 NTM; in 4 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 23 in the ORF — 0 in the essential state, 0 growth-defect, 23 non-essential, 0 growth-advantage. Saturation 0.957, mean read count 33.6818181818. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 141.0 ppm · rank 1051/3519 (70.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 199 aa |
|---|---|
| Molecular weight | 22.6 kDa |
| Theoretical pI | 8.82 |
| GRAVY | -0.128 (hydrophilic) |
| Aliphatic index | 107.3 |
| Aromaticity | 0.065 |
| Instability index | 44.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rv2949c-like | PF01947.22 | 4.8e-12 | 24–173 | Chorismate pyruvate-lyase Rv2949c-like |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2nwi-assembly3_F |
1.00 | 0.81 | 1.6e-10 sig | 2nwi-assembly3_F Crystal structure of protein AF1396 from Archaeoglobus fulgidus, Pfam DUF98 |
2nwi-assembly1_B |
1.00 | 0.79 | 9.2e-09 sig | 2nwi-assembly1_B Crystal structure of protein AF1396 from Archaeoglobus fulgidus, Pfam DUF98 |
4zsk-assembly1_B |
1.00 | 0.71 | 1.3e-06 sig | 4zsk-assembly1_B Crystal structure of the effector-binding domain of DasR (DasR-EBD) in complex with N-acetylglucosamine-6-phosphate |
1xlr-assembly1_A |
1.00 | 0.71 | 2.3e-06 sig | 1xlr-assembly1_A CHORISMATE LYASE WITH INHIBITOR VANILLATE |
3l5z-assembly1_B |
1.00 | 0.71 | 9.8e-06 sig | 3l5z-assembly1_B Crystal structure of transcriptional regulator, GntR family from Bacillus cereus |
Foldseek search of the AlphaFold DB model (mean pLDDT 82.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | fadD22 (- strand, 16 bp gap) |
|---|---|
| Downstream (3' on genome) | fadD29 (- strand, 25 bp gap) |
| Predicted operon |
pks1 · pks15 · fadD22 · Rv2949c · fadD29
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0023 (represses) · cmtR (represses) · tcrX (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: fadD22 (p-hydroxybenzoyl--AMP ligase), high confidence from genomic context alone (score 981 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2948c fadD22 exp |
p-hydroxybenzoyl--AMP ligase | 987 | 981 ctx | neighborhood:739 coexpression:839 database:500 |
Rv2950c fadD29 |
long-chain-fatty-acid--AMP ligase FadD29 | 983 | 976 ctx | neighborhood:835 coexpression:860 |
Rv2947c pks15 |
polyketide synthase | 949 | 939 ctx | neighborhood:746 coexpression:770 |
Rv3215 entC exp |
isochorismate synthase | 910 | 901 | database:900 |
Rv0948c exp |
chorismate mutase | 821 | 810 | database:800 |
Rv1885c exp |
chorismate mutase | 820 | 809 | database:800 |
Rv1609 trpE exp |
anthranilate synthase component I | 818 | 808 | database:800 |
Rv2540c aroF exp |
chorismate synthase | 808 | 801 | database:800 |
Rv1600 hisC1 exp |
histidinol-phosphate aminotransferase | 800 | 801 | database:800 |
Rv3772 hisC2 exp |
histidinol-phosphate aminotransferase | 800 | 800 | database:800 |
Rv2231c cobC exp |
aminotransferase | 800 | 800 | database:800 |
Rv2946c pks1 |
polyketide synthase | 816 | 778 ctx | neighborhood:767 |
Rv0355c PPE8 |
PPE family protein PPE8 | 767 | 767 ctx | cooccurence:766 |
Rv3347c PPE55 |
PPE family protein PPE55 | 765 | 766 ctx | cooccurence:764 |
Rv3343c PPE54 |
PPE family protein PPE54 | 764 | 765 ctx | cooccurence:757 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: chorismate pyruvate-lyase
- MTBC0 PGAP product: chorismate pyruvate-lyase family protein
- Pfam (hmmscan --cut_ga): Rv2949c-like PF01947.22 (E=5e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217465.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rv2949c-like (PF01947.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3161 - Curated reference: UniProt P9WIC5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
117 functional partner(s); context anchor
fadD22 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003131|Rv2949c| MTECFLSDQEIRKLNRDLRILIAANGTLTRVLNIVADDEVIVQIVKQRIHDVSPKLSEFEQLGQVGVGRVLQRYIILKGRNSEHLFVAAESLIAIDRLPAAIITRLTQTNDPLGEVMAASHIETFKEEAKVWVGDLPGWLALHGYQNSRKRAVARRYRVISGGQPIMVVTEHFLRSVFRDAPHEEPDRWQFSNAITLAR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2949c? Email the maintainer — the message is pre-filled with this gene's details.