rimI Resolved · high auto-curated

H37Rv Rv3420c · MTBC0 mtbc0_003634 · 158 aa · 3864025–3864501 (-) · RefSeq NP_217937.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribosomal-protein-alanine acetyltransferase RimI
MTBC0 PGAP re-annotationribosomal protein S18-alanine N-acetyltransferase
Revised (this work)Ribosomal protein S18-alanine N-acetyltransferase. Pfam: Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14), Acetyltransf_7 (PF13508.14), FR47 (PF08445.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YG32 SwissProt · reviewed · Evidence at protein level
UniProt nameN-alpha-acetyltransferase RimI
EC (curated) EC 2.3.1.255, EC 2.3.1.258
Curated functionN-alpha-acetyltransferase that specifically mediates the acetylation of N-terminal residues. Able to mediate acetylation of a wide variety of N-terminal residues, with preference for hydrophobic N-termini. Acetylates GroS/GroES and GroEL1. Able to acetylate the ribosomal protein bS18, but it is unclear whether it acetylates its N-terminal alanine residue.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerimI
eggNOG descriptionThis enzyme acetylates the N-terminal alanine of ribosomal protein S18
Orthologous groupCOG0454
EC number EC 2.3.1.128
KEGG orthology K03789
Gene Ontology (31) GO:0003674, GO:0003824, GO:0004596, GO:0006464, GO:0006473, GO:0006474, GO:0006807, GO:0008080, GO:0008150, GO:0008152, GO:0009987, GO:0010467 +19 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.365 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_1PF00583.32 3.3e-2330–130 Acetyltransferase (GNAT) family
Acetyltransf_10PF13673.14 5.3e-1437–137 Acetyltransferase (GNAT) domain
Acetyltransf_7PF13508.14 4.4e-1548–131 Acetyltransferase (GNAT) domain
FR47PF08445.17 1.1e-0579–133 FR47-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gcp (O-sialoglycoprotein endopeptidase), high confidence from genomic context alone (score 902 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3421c tsaB hyp hypothetical protein 996 974 ctx neighborhood:882 fusion:634 textmining:878
Rv3419c gcp O-sialoglycoprotein endopeptidase 980 902 ctx neighborhood:882 textmining:810
Rv3422c tsaE tRNA threonylcarbamoyladenosine biosynthesis protein 985 889 ctx neighborhood:881 textmining:876
Rv3423c alr alanine racemase 928 886 ctx neighborhood:881
Rv3432c gadB glutamate decarboxylase GadB 551 552 ctx neighborhood:544
Rv3418c groES chaperonin GroES 656 533 ctx neighborhood:531
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 485 485 ctx neighborhood:476
Rv0918 hyp hypothetical protein 470 468 experimental:451
Rv2803 hyp hypothetical protein 470 468 experimental:451
Rv3417c groEL1 chaperonin GroEL 620 462 ctx neighborhood:445
Rv3424c hyp hypothetical protein 416 416 ctx neighborhood:408
Rv0995 rimJ ribosomal-protein-alanine acetyltransferase RimJ 920 305 textmining:890
Rv0408 pta phosphate acetyltransferase 579 82 textmining:560
Rv2005c universal stress protein 623 64 textmining:614
Rv2624c universal stress protein 445 64 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribosomal-protein-alanine acetyltransferase RimI
  • MTBC0 PGAP product: ribosomal protein S18-alanine N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_1 PF00583.32 (E=3e-23), Acetyltransf_10 PF13673.14 (E=5e-14), Acetyltransf_7 PF13508.14 (E=4e-15), FR47 PF08445.17 (E=1e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217937.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14), Acetyltransf_7 (PF13508.14), FR47 (PF08445.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0454
  • Curated reference: UniProt I6YG32 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor gcp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003634|Rv3420c|rimI
MTADTEPVTIGALTRADAQRCAELEAQLFVGDDPWPPAAFNRELASPHNHYVGARSGGTLVGYAGISRLGRTPPFEYEVHTIGVDPAYQGRGIGRRLLRELLDFARGGVVYLEVRTDNDAALALYRSVGFQRVGLRRRYYRVSGADAYTMRRDSGDPS