rimI Resolved · high auto-curated
H37Rv Rv3420c · MTBC0 mtbc0_003634 ·
158 aa · 3864025–3864501 (-) ·
RefSeq NP_217937.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ribosomal-protein-alanine acetyltransferase RimI |
|---|---|
| MTBC0 PGAP re-annotation | ribosomal protein S18-alanine N-acetyltransferase |
| Revised (this work) | Ribosomal protein S18-alanine N-acetyltransferase. Pfam: Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14), Acetyltransf_7 (PF13508.14), FR47 (PF08445.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YG32
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | N-alpha-acetyltransferase RimI |
| EC (curated) |
EC 2.3.1.255, EC 2.3.1.258
|
| Curated function | N-alpha-acetyltransferase that specifically mediates the acetylation of N-terminal residues. Able to mediate acetylation of a wide variety of N-terminal residues, with preference for hydrophobic N-termini. Acetylates GroS/GroES and GroEL1. Able to acetylate the ribosomal protein bS18, but it is unclear whether it acetylates its N-terminal alanine residue. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | rimI |
| eggNOG description | This enzyme acetylates the N-terminal alanine of ribosomal protein S18 |
| Orthologous group | COG0454 |
| EC number |
EC 2.3.1.128
|
| KEGG orthology |
K03789
|
| Gene Ontology (31) |
GO:0003674, GO:0003824, GO:0004596, GO:0006464, GO:0006473, GO:0006474, GO:0006807, GO:0008080, GO:0008150, GO:0008152, GO:0009987, GO:0010467 +19 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.365 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_1 | PF00583.32 | 3.3e-23 | 30–130 | Acetyltransferase (GNAT) family |
Acetyltransf_10 | PF13673.14 | 5.3e-14 | 37–137 | Acetyltransferase (GNAT) domain |
Acetyltransf_7 | PF13508.14 | 4.4e-15 | 48–131 | Acetyltransferase (GNAT) domain |
FR47 | PF08445.17 | 1.1e-05 | 79–133 | FR47-like protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: gcp (O-sialoglycoprotein endopeptidase), high confidence from genomic context alone (score 902 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3421c tsaB hyp |
hypothetical protein | 996 | 974 ctx | neighborhood:882 fusion:634 textmining:878 |
Rv3419c gcp |
O-sialoglycoprotein endopeptidase | 980 | 902 ctx | neighborhood:882 textmining:810 |
Rv3422c tsaE |
tRNA threonylcarbamoyladenosine biosynthesis protein | 985 | 889 ctx | neighborhood:881 textmining:876 |
Rv3423c alr |
alanine racemase | 928 | 886 ctx | neighborhood:881 |
Rv3432c gadB |
glutamate decarboxylase GadB | 551 | 552 ctx | neighborhood:544 |
Rv3418c groES |
chaperonin GroES | 656 | 533 ctx | neighborhood:531 |
Rv3433c nnr |
bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | 485 | 485 ctx | neighborhood:476 |
Rv0918 hyp |
hypothetical protein | 470 | 468 | experimental:451 |
Rv2803 hyp |
hypothetical protein | 470 | 468 | experimental:451 |
Rv3417c groEL1 |
chaperonin GroEL | 620 | 462 ctx | neighborhood:445 |
Rv3424c hyp |
hypothetical protein | 416 | 416 ctx | neighborhood:408 |
Rv0995 rimJ |
ribosomal-protein-alanine acetyltransferase RimJ | 920 | 305 | textmining:890 |
Rv0408 pta |
phosphate acetyltransferase | 579 | 82 | textmining:560 |
Rv2005c |
universal stress protein | 623 | 64 | textmining:614 |
Rv2624c |
universal stress protein | 445 | 64 | textmining:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ribosomal-protein-alanine acetyltransferase RimI
- MTBC0 PGAP product: ribosomal protein S18-alanine N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_1 PF00583.32 (E=3e-23), Acetyltransf_10 PF13673.14 (E=5e-14), Acetyltransf_7 PF13508.14 (E=4e-15), FR47 PF08445.17 (E=1e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217937.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14), Acetyltransf_7 (PF13508.14), FR47 (PF08445.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt I6YG32 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
gcp - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003634|Rv3420c|rimI MTADTEPVTIGALTRADAQRCAELEAQLFVGDDPWPPAAFNRELASPHNHYVGARSGGTLVGYAGISRLGRTPPFEYEVHTIGVDPAYQGRGIGRRLLRELLDFARGGVVYLEVRTDNDAALALYRSVGFQRVGLRRRYYRVSGADAYTMRRDSGDPS