rimI Resolved · high auto-curated
H37Rv Rv3420c · MTBC0 mtbc0_003634 ·
158 aa ·
3864025–3864501 MTBC0
(-) ·
RefSeq NP_217937.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ribosomal-protein-alanine acetyltransferase RimI |
|---|---|
| MTBC0 PGAP re-annotation | ribosomal protein S18-alanine N-acetyltransferase |
| Revised (this work) | Ribosomal protein S18-alanine N-acetyltransferase. Pfam: Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14), Acetyltransf_7 (PF13508.14), FR47 (PF08445.17). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| The physiological effect of rimI/rimJ silencing by CRISPR interference in Mycobacterium smegmatis mc2155. doi:10.1007/s00203-023-03561-5 | 2023 |
| Biophysical and functional characterizations of recombinant RimI acetyltransferase from Mycobacterium tuberculosis. doi:10.1093/abbs/gmz075 | 2019 |
| The alr-groEL1 operon in Mycobacterium tuberculosis: an interplay of multiple regulatory elements. doi:10.1038/srep43772 | 2017 |
| Biochemical evidence for relaxed substrate specificity of Nα-acetyltransferase (Rv3420c/rimI) of Mycobacterium tuberculosis. doi:10.1038/srep28892 | 2016 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | tsaD (Rv3419c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.53 (95% CI -3.75 to 3.22). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Acetylates the N-terminal alanine of ribosomal protein S18 [catalytic activity: acetyl-CoA + ribosomal-protein L-alanine = CoA + ribosomal-protein N-acetyl-L-alanine]. |
|---|---|
| Mycobrowser EC |
2.3.1.128
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3454c
· 99.4% identity |
|---|---|
| M. marinum |
MMAR_1123
· 81.9% identity |
| M. smegmatis |
MSMEG_1579
· 67.1% identity |
| M. orygis |
RJtmp_003522
· 99.4% identity |
| M. abscessus |
MAB_3735c
· 65.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6YG32
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | N-alpha-acetyltransferase RimI |
| EC (curated) |
EC 2.3.1.255, EC 2.3.1.258
|
| Curated function | N-alpha-acetyltransferase that specifically mediates the acetylation of N-terminal residues. Able to mediate acetylation of a wide variety of N-terminal residues, with preference for hydrophobic N-termini. Acetylates GroS/GroES and GroEL1. Able to acetylate the ribosomal protein bS18, but it is unclear whether it acetylates its N-terminal alanine residue. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | rimI |
| eggNOG description | This enzyme acetylates the N-terminal alanine of ribosomal protein S18 |
| Orthologous group | COG0454 |
| EC number |
EC 2.3.1.128
|
| KEGG orthology |
K03789
|
| Gene Ontology (31) |
GO:0003674, GO:0003824, GO:0004596, GO:0006464, GO:0006473, GO:0006474, GO:0006807, GO:0008080, GO:0008150, GO:0008152, GO:0009987, GO:0010467 +19 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.365 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 49.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 50.3636363636. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 10 (in vivo) | -3.50 | 0.041 | required |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +2.59 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 7.45 ppm · rank 2789/3519 (20.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 158 aa |
|---|---|
| Molecular weight | 17.4 kDa |
| Theoretical pI | 7.91 |
| GRAVY | -0.395 (hydrophilic) |
| Aliphatic index | 77.8 |
| Aromaticity | 0.095 |
| Instability index | 39.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_1 | PF00583.32 | 3.3e-23 | 30–130 | Acetyltransferase (GNAT) family |
Acetyltransf_10 | PF13673.14 | 5.3e-14 | 37–137 | Acetyltransferase (GNAT) domain |
Acetyltransf_7 | PF13508.14 | 4.4e-15 | 48–131 | Acetyltransferase (GNAT) domain |
FR47 | PF08445.17 | 1.1e-05 | 79–133 | FR47-like protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2cnt-assembly4_D |
1.00 | 0.85 | 4.0e-12 sig | 2cnt-assembly4_D RimI - Ribosomal S18 N-alpha-protein acetyltransferase in complex with CoenzymeA. |
5icw-assembly3_C-3 |
1.00 | 0.79 | 4.9e-11 sig | 5icw-assembly3_C-3 Crystal structure of human NatF (hNaa60) homodimer bound to Coenzyme A |
4pv6-assembly8_N |
1.00 | 0.82 | 8.5e-11 sig | 4pv6-assembly8_N Crystal Structure Analysis of Ard1 from Thermoplasma volcanium |
7l1k-assembly1_A |
1.00 | 0.86 | 6.0e-10 sig | 7l1k-assembly1_A Cryo-EM structure of S. Pombe NatC complex with a Bisubstrate inhibitor and inositol hexaphosphate |
5ix3-assembly1_A |
1.00 | 0.73 | 3.1e-11 sig | 5ix3-assembly1_A Crystal structure of N-acetyltransferase from Staphylococcus aureus. |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | gcp (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3421c (- strand, -4 bp gap) |
| Predicted operon |
gcp · rimI · Rv3421c · Rv3422c · alr
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: gcp (O-sialoglycoprotein endopeptidase), high confidence from genomic context alone (score 902 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3421c tsaB hyp |
hypothetical protein | 996 | 974 ctx | neighborhood:882 fusion:634 textmining:878 |
Rv3419c gcp |
O-sialoglycoprotein endopeptidase | 980 | 902 ctx | neighborhood:882 textmining:810 |
Rv3422c tsaE |
tRNA threonylcarbamoyladenosine biosynthesis protein | 985 | 889 ctx | neighborhood:881 textmining:876 |
Rv3423c alr |
alanine racemase | 928 | 886 ctx | neighborhood:881 |
Rv3432c gadB |
glutamate decarboxylase GadB | 551 | 552 ctx | neighborhood:544 |
Rv3418c groES |
chaperonin GroES | 656 | 533 ctx | neighborhood:531 |
Rv3433c nnr |
bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | 485 | 485 ctx | neighborhood:476 |
Rv0918 hyp exp |
hypothetical protein | 470 | 468 | experimental:451 |
Rv2803 hyp exp |
hypothetical protein | 470 | 468 | experimental:451 |
Rv3417c groEL1 |
chaperonin GroEL | 620 | 462 ctx | neighborhood:445 |
Rv3424c hyp |
hypothetical protein | 416 | 416 ctx | neighborhood:408 |
Rv0995 rimJ |
ribosomal-protein-alanine acetyltransferase RimJ | 920 | 305 | textmining:890 |
Rv0408 pta |
phosphate acetyltransferase | 579 | 82 | textmining:560 |
Rv2005c |
universal stress protein | 623 | 64 | textmining:614 |
Rv2624c |
universal stress protein | 445 | 64 | textmining:432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ribosomal-protein-alanine acetyltransferase RimI
- MTBC0 PGAP product: ribosomal protein S18-alanine N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_1 PF00583.32 (E=3e-23), Acetyltransf_10 PF13673.14 (E=5e-14), Acetyltransf_7 PF13508.14 (E=4e-15), FR47 PF08445.17 (E=1e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217937.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14), Acetyltransf_7 (PF13508.14), FR47 (PF08445.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt I6YG32 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
gcp - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003634|Rv3420c|rimI MTADTEPVTIGALTRADAQRCAELEAQLFVGDDPWPPAAFNRELASPHNHYVGARSGGTLVGYAGISRLGRTPPFEYEVHTIGVDPAYQGRGIGRRLLRELLDFARGGVVYLEVRTDNDAALALYRSVGFQRVGLRRRYYRVSGADAYTMRRDSGDPS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rimI? Email the maintainer — the message is pre-filled with this gene's details.