Rv0911 Family assigned · medium auto-curated
H37Rv Rv0911 · MTBC0 mtbc0_000966 ·
257 aa · 1018613–1019386 (+) ·
RefSeq NP_215426.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | VOC family protein |
| Revised (this work) | VOC family protein. Pfam: Ble-like_N (PF22677.3), Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XA34
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Glyoxalase bleomycin resistance protein dioxygenase |
| Orthologous group | COG3324 |
| KEGG orthology |
K06996
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.259 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ble-like_N | PF22677.3 | 5.7e-06 | 14–39 | Bleomycin resistance protein-like N-terminal |
Glyoxalase | PF00903.32 | 1.7e-08 | 144–251 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
Glyoxalase_6 | PF18029.8 | 7.7e-05 | 147–252 | Glyoxalase-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0912 (transmembrane protein), high confidence from genomic context alone (score 799 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0912 |
transmembrane protein | 959 | 799 ctx | neighborhood:796 textmining:806 |
Rv1681 moeX |
molybdopterin biosynthesis protein MoeX | 734 | 734 | coexpression:733 |
Rv0910 |
toxin | 619 | 620 ctx | neighborhood:614 |
Rv0909 |
antitoxin | 619 | 620 ctx | neighborhood:604 |
Rv1679 fadE16 |
acyl-CoA dehydrogenase FadE16 | 457 | 458 | coexpression:458 |
Rv0906 hyp |
hypothetical protein | 452 | 453 ctx | neighborhood:450 |
Rv0905 echA6 |
enoyl-CoA hydratase EchA6 | 448 | 448 ctx | neighborhood:448 |
Rv1680 hyp |
hypothetical protein | 422 | 423 | coexpression:423 |
Rv0887c hyp |
hypothetical protein | 864 | 335 | textmining:805 |
Rv0577 TB27.3 hyp |
hypothetical protein | 406 | 246 | |
Rv1510 hyp |
hypothetical protein | 677 | 89 | textmining:660 |
Rv0886 fprB |
ferredoxin/ferredoxin--NADP reductase | 530 | 75 | textmining:513 |
Rv1731 gabD2 |
succinate-semialdehyde dehydrogenase | 622 | 54 | textmining:617 |
Rv2010 vapC15 |
ribonuclease VapC15 | 524 | 54 | textmining:518 |
Rv0181c hyp |
hypothetical protein | 806 | 52 | textmining:804 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: VOC family protein
- Pfam (hmmscan --cut_ga): Ble-like_N PF22677.3 (E=6e-06), Glyoxalase PF00903.32 (E=2e-08), Glyoxalase_6 PF18029.8 (E=8e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215426.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ble-like_N (PF22677.3), Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3324 - Curated reference: UniProt I6XA34 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
Rv0912 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000966|Rv0911| MPTRSSAPLGAPCWIDLTTSDVDRAQDFYGTVFGWAFESAGPDYGGYINAAKGGHPVAGLMANRPEFQSPDGWATYFHTVDIGATVAKLAAAGGSSCLDPMEVPGKGFMSLAVDPSGAAFGLWQPLQHHGFEVIGEAGSPVWHQLTTRDYRSVIDFYRQVFGWRTEQISDTDEFCYTTAWFDDQQLLGVMDGSSCLPEGVPSNWTIFFGAEDVDETLRVICDNGGSVVRAAENTPYGRLAAAADPMGVVFNLSSLQA