Rv0911 Family assigned · medium auto-curated

H37Rv Rv0911 · MTBC0 mtbc0_000966 · 257 aa · 1018613–1019386 (+) · RefSeq NP_215426.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationVOC family protein
Revised (this work)VOC family protein. Pfam: Ble-like_N (PF22677.3), Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XA34 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionGlyoxalase bleomycin resistance protein dioxygenase
Orthologous groupCOG3324
KEGG orthology K06996

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.259 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ble-like_NPF22677.3 5.7e-0614–39 Bleomycin resistance protein-like N-terminal
GlyoxalasePF00903.32 1.7e-08144–251 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Glyoxalase_6PF18029.8 7.7e-05147–252 Glyoxalase-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0912 (transmembrane protein), high confidence from genomic context alone (score 799 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0912 transmembrane protein 959 799 ctx neighborhood:796 textmining:806
Rv1681 moeX molybdopterin biosynthesis protein MoeX 734 734 coexpression:733
Rv0910 toxin 619 620 ctx neighborhood:614
Rv0909 antitoxin 619 620 ctx neighborhood:604
Rv1679 fadE16 acyl-CoA dehydrogenase FadE16 457 458 coexpression:458
Rv0906 hyp hypothetical protein 452 453 ctx neighborhood:450
Rv0905 echA6 enoyl-CoA hydratase EchA6 448 448 ctx neighborhood:448
Rv1680 hyp hypothetical protein 422 423 coexpression:423
Rv0887c hyp hypothetical protein 864 335 textmining:805
Rv0577 TB27.3 hyp hypothetical protein 406 246
Rv1510 hyp hypothetical protein 677 89 textmining:660
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 530 75 textmining:513
Rv1731 gabD2 succinate-semialdehyde dehydrogenase 622 54 textmining:617
Rv2010 vapC15 ribonuclease VapC15 524 54 textmining:518
Rv0181c hyp hypothetical protein 806 52 textmining:804

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: VOC family protein
  • Pfam (hmmscan --cut_ga): Ble-like_N PF22677.3 (E=6e-06), Glyoxalase PF00903.32 (E=2e-08), Glyoxalase_6 PF18029.8 (E=8e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215426.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ble-like_N (PF22677.3), Glyoxalase (PF00903.32), Glyoxalase_6 (PF18029.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3324
  • Curated reference: UniProt I6XA34 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor Rv0912
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000966|Rv0911|
MPTRSSAPLGAPCWIDLTTSDVDRAQDFYGTVFGWAFESAGPDYGGYINAAKGGHPVAGLMANRPEFQSPDGWATYFHTVDIGATVAKLAAAGGSSCLDPMEVPGKGFMSLAVDPSGAAFGLWQPLQHHGFEVIGEAGSPVWHQLTTRDYRSVIDFYRQVFGWRTEQISDTDEFCYTTAWFDDQQLLGVMDGSSCLPEGVPSNWTIFFGAEDVDETLRVICDNGGSVVRAAENTPYGRLAAAADPMGVVFNLSSLQA