Rv0913c Family assigned · medium auto-curated

H37Rv Rv0913c · MTBC0 mtbc0_000969 · 502 aa · 1020432–1021940 (-) · RefSeq NP_215428.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dioxygenase
MTBC0 PGAP re-annotationcarotenoid oxygenase family protein
Revised (this work)Carotenoid oxygenase family protein. Pfam: RPE65 (PF03055.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y551 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDioxygenase
EC (curated) EC 1.13.11.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptiondioxygenase
Orthologous groupCOG3670
KEGG orthology K11159

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.773 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 8 missense, 2 nonsense, 0 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.45% of strains (649) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RPE65PF03055.22 7.5e-12027–483 Retinal pigment epithelial membrane protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0914c (lipid carrier protein or keto acyl-CoA thiolase), high confidence from genomic context alone (score 977 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0914c lipid carrier protein or keto acyl-CoA thiolase 977 977 ctx neighborhood:881 cooccurence:756
Rv1389 gmk guanylate kinase 576 577 database:573
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 568 568 database:563
Rv1819c bacA vitamin B12 transport ATP-binding protein BacA 565 565 database:563
Rv3418c groES chaperonin GroES 563 563 database:563
Rv1362c membrane protein 573 557
Rv1488 hyp hypothetical protein 554 554 database:552
Rv0915c PPE14 PPE family protein PPE14 548 548 ctx neighborhood:546
Rv2213 pepB cytosol aminopeptidase 561 544 database:544
Rv1770 hyp hypothetical protein 541 541 database:528
Rv0418 lpqL lipoprotein aminopeptidase LpqL 539 540 database:528
Rv0916c PE7 PE family protein PE7 528 528 ctx neighborhood:528
Rv1363c membrane protein 536 518
Rv0070c glyA2 serine hydroxymethyltransferase 493 493 database:492
Rv3492c Mce associated protein 457 437

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dioxygenase
  • MTBC0 PGAP product: carotenoid oxygenase family protein
  • Pfam (hmmscan --cut_ga): RPE65 PF03055.22 (E=8e-120)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215428.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RPE65 (PF03055.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3670
  • Curated reference: UniProt I6Y551 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s); context anchor Rv0914c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000969|Rv0913c|
MDITIVGKYLSTLPEDDDHPYRTGPWRPQTTEWDADDLTTVTGEVPADLDGIYLRNTENPLHPAFATYHPFDGDGMIHVVGFRDGKAFYRNRFIRTDGFLAENEAGGPLWPGLAEPVQLAKREHGWGARGLMKDASSTDVIVHRGIALTSFYQCGDLYRIDPYSANTLGKESWHGRFPFDWGVSAHPKVDNKTGELLFFNYSKQEPYMRYGVVDQNNELVHYVDVPLPGPRLPHDMAFTENYVILNDFPLFWDPRLLERDVHLPRFYPEIPSRFAVVARRGNDIRWFEADPTFVLHFTNAYEQGDEIVLDGFYEGDPQPLDTGGTKWEKLFRFLALDRLQSRLHRWRLNMVTGAVHEEQLSESITEFGTINADYAASSYRYTYAATGKPSWFLFDGLVKHDLLTGNHECYSFGDGVYGSETAMAPRVGSSAEDDGYLVTLTTDMNDDASYCLVFDAARPGDGPICKLALPERISSGTHSAWVPGAELRRWDHAESPAAAVGL