Rv1999c Family assigned · medium auto-curated

H37Rv Rv1999c · MTBC0 mtbc0_002126 · 440 aa · 2267429–2268751 (-) · RefSeq NP_216515.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transporter
MTBC0 PGAP re-annotationAPC family permease
Revised (this work)APC family permease. Pfam: AA_permease_2 (PF13520.13), AA_permease (PF00324.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQM3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized transporter Rv1999c
Curated functionProbable amino-acid or metabolite transport protein.

UniProt still lists this protein as Uncharacterized transporter Rv1999c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
eggNOG descriptionamino acid
Orthologous groupCOG0531
KEGG orthology K03294

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.917 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 9 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 1.47% of strains (2136) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AA_permease_2PF13520.13 6.1e-4418–403 Amino acid permease
AA_permeasePF00324.28 3.8e-3523–344 Amino acid permease

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0541c (integral membrane protein), medium confidence from genomic context alone (score 547 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0650 sugar kinase 824 823 coexpression:822
Rv0218 transmembrane protein 788 781 coexpression:774
Rv1327c glgE alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase 775 764 experimental:451 database:577
Rv2471 aglA alpha-glucosidase AglA 774 763 experimental:451 database:577
Rv0126 treS trehalose synthase/amylase TreS 774 763 experimental:451 database:577
Rv0648 alpha-mannosidase 734 733 coexpression:733
Rv1998c hyp hypothetical protein 636 637 ctx neighborhood:583
Rv2000 hyp hypothetical protein 556 555 ctx neighborhood:554
Rv2001 hyp hypothetical protein 547 547 ctx neighborhood:547
Rv0541c integral membrane protein 546 547 ctx neighborhood:544
Rv0649 fabD2 malonyl CoA-acyl carrier protein transacylase 441 441 coexpression:441
Rv0689c hyp hypothetical protein 431 431 coexpression:431
Rv0178 Mce associated membrane protein 441 419
Rv1973 Mce associated membrane protein 440 419
Rv1972 Mce associated membrane protein 439 417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transporter
  • MTBC0 PGAP product: APC family permease
  • Pfam (hmmscan --cut_ga): AA_permease_2 PF13520.13 (E=6e-44), AA_permease PF00324.28 (E=4e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216515.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AA_permease_2 (PF13520.13), AA_permease (PF00324.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0531
  • Curated reference: UniProt P9WQM3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv0541c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002126|Rv1999c|
MRRPLDPRDIPDELRRRLGLLDAVVIGLGSMIGAGIFAALAPAAYAAGSGLLLGLAVAAVVAYCNAISSARLAARYPASGGTYVYGRMRLGDFWGYLAGWGFVVGKTASCAAMALTVGFYVWPAQAHAVAVAVVVALTAVNYAGIQKSAWLTRSIVAVVLVVLTAVVVAAYGSGAADPARLDIGVDAHVWGMLQAAGLLFFAFAGYARIATLGEEVRDPARTIPRAIPLALGITLAVYALVAVAVIAVLGPQRLARAAAPLSEAMRVAGVNWLIPVVQIGAAVAALGSLLALILGVSRTTLAMARDRHLPRWLAAVHPRFKVPFRAELVVGAVVAALAATADIRGAIGFSSFGVLVYYAIANASALTLGLDEGRPRRLIPLVGLIGCVVLAFALPLSSVAAGAAVLGVGVAAYGVRRIITRRARQTDSGDTQRSGHPSAT