rplA Resolved · high auto-curated

H37Rv Rv0641 · MTBC0 mtbc0_000679 · 235 aa · 739070–739777 (+) · RefSeq NP_215155.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L1
MTBC0 PGAP re-annotation50S ribosomal protein L1
Revised (this work)50S ribosomal protein L1. Pfam: Ribosomal_L1 (PF00687.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHC7 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL1
Curated functionBinds directly to 23S rRNA. The L1 stalk is very mobile in the ribosome, and is involved in E site tRNA release..; FUNCTION: Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplA
eggNOG descriptionBinds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release
Orthologous groupCOG0081
KEGG orthology K02863
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (76) GO:0000470, GO:0003674, GO:0003676, GO:0003723, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840 +64 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.342 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L1PF00687.27 1.7e-6631–220 Ribosomal protein L1p/L10e family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplK (50S ribosomal protein L11), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0723 rplO 50S ribosomal protein L15 999 999 coexpression:957 experimental:928 database:571
Rv0640 rplK 50S ribosomal protein L11 999 999 ctx neighborhood:795 cooccurence:476 coexpression:893 experimental:928 textmining:677
Rv0708 rplP 50S ribosomal protein L16 999 998 coexpression:955 experimental:928 database:495 textmining:596
Rv0651 rplJ 50S ribosomal protein L10 998 998 coexpression:861 experimental:928 database:693 textmining:415
Rv0706 rplV 50S ribosomal protein L22 998 998 coexpression:882 experimental:928 database:774
Rv0709 rpmC 50S ribosomal protein L29 998 998 coexpression:894 experimental:928 database:693
Rv3443c rplM 50S ribosomal protein L13 999 997 coexpression:863 experimental:928 database:582 textmining:732
Rv0702 rplD 50S ribosomal protein L4 999 997 coexpression:875 experimental:928 database:651 textmining:766
Rv0716 rplE 50S ribosomal protein L5 999 997 coexpression:864 experimental:928 database:571 textmining:724
Rv0722 rpmD 50S ribosomal protein L30 998 997 coexpression:860 experimental:928 database:678 textmining:498
Rv3456c rplQ 50S ribosomal protein L17 998 997 coexpression:959 experimental:928
Rv0719 rplF 50S ribosomal protein L6 998 997 coexpression:877 experimental:928 database:597 textmining:620
Rv0701 rplC 50S ribosomal protein L3 998 997 coexpression:896 experimental:928 database:616 textmining:614
Rv0703 rplW 50S ribosomal protein L23 998 997 coexpression:875 experimental:928 database:693 textmining:585
Rv0704 rplB 50S ribosomal protein L2 998 997 coexpression:908 experimental:928 database:546 textmining:621

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L1
  • MTBC0 PGAP product: 50S ribosomal protein L1
  • Pfam (hmmscan --cut_ga): Ribosomal_L1 PF00687.27 (E=2e-66)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215155.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L1 (PF00687.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0081
  • Curated reference: UniProt P9WHC7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 232 functional partner(s); context anchor rplK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000679|Rv0641|rplA
MSKTSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERIQGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGIPVDPSITRNFAGE