secE1 Resolved · high auto-curated

H37Rv Rv0638 · MTBC0 - · 161 aa · 733737–734222 (+) · RefSeq YP_177743.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)preprotein translocase SecE
MTBC0 PGAP re-annotation
Revised (this work)Preprotein translocase SecE. Pfam: SecE (PF00584.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WGN7 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein translocase subunit SecE
Curated functionEssential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
Preferred namesecE
eggNOG descriptionEssential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation
Orthologous groupCOG0690
KEGG orthology K03073
KEGG pathways map02024, map03060, map03070
KEGG modules M00335
Gene Ontology (16) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005887, GO:0008150, GO:0016020, GO:0016021, GO:0030312, GO:0031224, GO:0031226, GO:0040007 +4 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SecEPF00584.26 1.2e-18107–160 SecE/Sec61-gamma subunits of protein translocation complex

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nusG (transcription termination/antitermination protein NusG), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1440 secG protein-export membrane protein SecG 999 998 coexpression:668 experimental:928 database:900 textmining:965
Rv0732 secY preprotein translocase SecY 999 996 coexpression:520 experimental:928 database:900 textmining:979
Rv0639 nusG transcription termination/antitermination protein NusG 996 994 ctx neighborhood:835 coexpression:968 textmining:461
Rv0640 rplK 50S ribosomal protein L11 996 994 ctx neighborhood:775 coexpression:957 experimental:474 textmining:424
Rv0641 rplA 50S ribosomal protein L1 986 978 ctx neighborhood:719 coexpression:862 experimental:474 textmining:407
Rv3240c secA1 protein translocase subunit SecA 996 977 experimental:775 database:900 textmining:873
Rv1821 secA2 accessory Sec system translocase SecA2 993 977 experimental:775 database:900 textmining:724
Rv3921c yidC membrane protein insertase YidC 980 957 experimental:474 database:900 textmining:564
Rv2916c ffh signal recognition particle protein 981 954 experimental:446 database:900 textmining:622
Rv2921c ftsY signal recognition particle receptor FtsY 989 946 experimental:474 database:900 textmining:810
Rv2588c yajC membrane protein secretion factor YajC 984 940 coexpression:426 database:900 textmining:745
Rv0634B rpmG2 50S ribosomal protein L33 934 926 ctx neighborhood:544 coexpression:729 experimental:446
Rv0701 rplC 50S ribosomal protein L3 923 923 coexpression:848 experimental:474
Rv0651 rplJ 50S ribosomal protein L10 930 919 coexpression:827 experimental:474
Rv3458c rpsD 30S ribosomal protein S4 928 917 coexpression:840 experimental:474

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): preprotein translocase SecE
  • Pfam (hmmscan --cut_ga): SecE PF00584.26 (E=1e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177743.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SecE (PF00584.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0690
  • Curated reference: UniProt P9WGN7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 123 functional partner(s); context anchor nusG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0638|secE1
MSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKRSRSRAAGADADVDVEEPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG