rplK Resolved · high auto-curated

H37Rv Rv0640 · MTBC0 mtbc0_000678 · 142 aa · 738575–739003 (+) · RefSeq NP_215154.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L11
MTBC0 PGAP re-annotation50S ribosomal protein L11
Revised (this work)50S ribosomal protein L11. Pfam: Ribosomal_L11_N (PF03946.20), Ribosomal_L11 (PF00298.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHE5 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL11
Curated functionForms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplK
eggNOG descriptionForms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors
Orthologous groupCOG0080
KEGG orthology K02867
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (77) GO:0000027, GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737 +65 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.16 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L11_NPF03946.20 8.0e-3011–68 Ribosomal protein L11, N-terminal domain
Ribosomal_L11PF00298.25 2.1e-3073–141 Ribosomal protein L11, RNA binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplA (50S ribosomal protein L1), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:864 experimental:999 database:556 textmining:572
Rv0651 rplJ 50S ribosomal protein L10 999 1000 coexpression:859 experimental:997
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:858 experimental:997
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:859 experimental:999 database:404
Rv0500B Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ 999 999 experimental:999
Rv0641 rplA 50S ribosomal protein L1 999 999 ctx neighborhood:795 cooccurence:476 coexpression:893 experimental:928 textmining:677
Rv0719 rplF 50S ribosomal protein L6 999 998 coexpression:915 experimental:928 database:532 textmining:791
Rv0701 rplC 50S ribosomal protein L3 999 998 coexpression:885 experimental:928 database:766 textmining:516
Rv0639 nusG transcription termination/antitermination protein NusG 999 998 ctx neighborhood:809 cooccurence:449 coexpression:967 experimental:446 textmining:569
Rv0706 rplV 50S ribosomal protein L22 998 997 coexpression:889 experimental:928 database:588 textmining:587
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 998 997 ctx cooccurence:621 coexpression:918 experimental:908
Rv0704 rplB 50S ribosomal protein L2 998 997 coexpression:890 experimental:928 database:512 textmining:667
Rv0714 rplN 50S ribosomal protein L14 998 997 coexpression:864 experimental:928 database:556 textmining:614
Rv0722 rpmD 50S ribosomal protein L30 998 996 coexpression:862 experimental:928 database:564 textmining:647
Rv3443c rplM 50S ribosomal protein L13 998 996 coexpression:866 experimental:928 database:571 textmining:620

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L11
  • MTBC0 PGAP product: 50S ribosomal protein L11
  • Pfam (hmmscan --cut_ga): Ribosomal_L11_N PF03946.20 (E=8e-30), Ribosomal_L11 PF00298.25 (E=2e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215154.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L11_N (PF03946.20), Ribosomal_L11 (PF00298.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0080
  • Curated reference: UniProt P9WHE5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 349 functional partner(s); context anchor rplA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000678|Rv0640|rplK
MAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTWDQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE