hadC Family assigned · medium auto-curated
H37Rv Rv0637 · MTBC0 mtbc0_000674 ·
166 aa ·
736378–736878 MTBC0
(+) ·
RefSeq NP_215151.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | (3R)-hydroxyacyl-ACP dehydratase subunit HadC |
|---|---|
| MTBC0 PGAP re-annotation | (3R)-hydroxyacyl-ACP dehydratase subunit HadC |
| Revised (this work) | (3R)-hydroxyacyl-ACP dehydratase subunit HadC. Pfam: FAS1_DH_region (PF13452.12). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 14 publications
14 TB publications mention this gene. 14 publication(s) discuss this gene (14 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Inhibition of de novo fatty acid synthesis in Mycobacterium tuberculosis. doi:10.1016/j.jbc.2025.111022 | 2026 |
| 1,3-Diarylpyrazolyl-acylsulfonamides Target HadAB/BC Complex in Mycobacterium tuberculosis. doi:10.1021/acsinfecdis.2c00392 | 2022 |
| Knockdown of the Type-II Fatty acid synthase gene hadC in mycobacterium fortuitum does not affect its growth, biofilm formation, and survival under stress. doi:10.4103/ijmy.ijmy_46_22 | 2022 |
| The C-terminal end of mycobacterial HadBC regulates AcpM interaction during the FAS-II pathway: a structural perspective. doi:10.1111/febs.16405 | 2022 |
| Fluorescently labelled thioacetazone for detecting the interaction with Mycobacterium dehydratases HadAB and HadBC. doi:10.1039/d1ob02080c | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -3.63 (95% CI -7.48 to 1.30). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in fatty acid synthesis type II (fas-II) |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0656
· 100.0% identity |
|---|---|
| M. leprae |
ML1908c
· 88.6% identity |
| M. marinum |
MMAR_0970
· 80.1% identity |
| M. smegmatis |
MSMEG_1342
· 68.7% identity |
| M. orygis |
RJtmp_000672
· 100.0% identity |
| M. abscessus |
MAB_3896c
· 51.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFJ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | UPF0336 protein Rv0637 |
UniProt still lists this protein as UPF0336 protein Rv0637; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | hadA |
| eggNOG description | Belongs to the UPF0336 family |
| Orthologous group | COG2030 |
| Gene Ontology (41) |
GO:0001676, GO:0003674, GO:0003824, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006633, GO:0008150 +29 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.097 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 77.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 39.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 8 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 0.625, mean read count 78.8. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 523.0 ppm · rank 387/3519 (89.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 166 aa |
|---|---|
| Molecular weight | 18.9 kDa |
| Theoretical pI | 5.18 |
| GRAVY | -0.119 (hydrophilic) |
| Aliphatic index | 84.6 |
| Aromaticity | 0.108 |
| Instability index | 15.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FAS1_DH_region | PF13452.12 | 5.1e-25 | 15–137 | FAS1-like, dehydratase domain region |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5zy8 |
X-ray diffraction | 2.899 Å | 95% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5zy8-assembly1_C |
1.00 | 0.98 | 5.1e-23 sig | 5zy8-assembly1_C Crystal structure of C terminal truncated HadBC (3R-Hydroxyacyl-ACP Dehydratase) complex from Mycobacterium tuberculosis |
5zy8-assembly1_A |
1.00 | 0.95 | 1.2e-21 sig | 5zy8-assembly1_A Crystal structure of C terminal truncated HadBC (3R-Hydroxyacyl-ACP Dehydratase) complex from Mycobacterium tuberculosis |
4rlt-assembly1_A |
1.00 | 0.87 | 1.1e-17 sig | 4rlt-assembly1_A Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium tuberculosis complexed with Fisetin |
4rlw-assembly1_A |
1.00 | 0.87 | 2.6e-17 sig | 4rlw-assembly1_A Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium tuberculosis complexed with Butein |
4rlu-assembly1_A |
1.00 | 0.87 | 2.8e-17 sig | 4rlu-assembly1_A Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium tuberculosis complexed with 2',4,4'-trihydroxychalcone |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 6
| Upstream (5' on genome) | hadB (+ strand, 3 bp gap) |
|---|---|
| Downstream (3' on genome) | trpT (+ strand, 198 bp gap) |
| Predicted operon |
thrT · metT · rpmG2 · hadA · hadB · hadC
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hadB ((3R)-hydroxyacyl-ACP dehydratase subunit HadB), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0636 hadB exp |
(3R)-hydroxyacyl-ACP dehydratase subunit HadB | 999 | 1000 ctx | neighborhood:882 cooccurence:756 coexpression:855 experimental:999 textmining:934 |
Rv0635 hadA |
(3R)-hydroxyacyl-ACP dehydratase subunit HadA | 934 | 934 ctx | neighborhood:882 coexpression:431 |
Rv0718 rpsH |
30S ribosomal protein S8 | 806 | 805 | coexpression:805 |
Rv0704 rplB |
50S ribosomal protein L2 | 786 | 787 | coexpression:761 |
Rv0634B rpmG2 |
50S ribosomal protein L33 | 844 | 779 ctx | neighborhood:768 |
Rv0719 rplF |
50S ribosomal protein L6 | 770 | 770 | coexpression:770 |
Rv1630 rpsA |
30S ribosomal protein S1 | 857 | 758 | coexpression:757 textmining:437 |
Rv0715 rplX |
50S ribosomal protein L24 | 744 | 744 | coexpression:744 |
Rv0733 adk |
adenylate kinase | 747 | 738 | coexpression:736 |
Rv0723 rplO |
50S ribosomal protein L15 | 687 | 687 | coexpression:687 |
Rv0721 rpsE exp |
30S ribosomal protein S5 | 646 | 646 | coexpression:415 database:420 |
Rv3339c icd1 exp |
isocitrate dehydrogenase | 649 | 634 | database:476 |
Rv0632c echA3 |
enoyl-CoA hydratase EchA3 | 623 | 622 | |
Rv0639 nusG |
transcription termination/antitermination protein NusG | 611 | 612 ctx | neighborhood:544 |
Rv2242 hyp |
hypothetical protein | 600 | 600 ctx | cooccurence:599 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: (3R)-hydroxyacyl-ACP dehydratase subunit HadC
- MTBC0 PGAP product: (3R)-hydroxyacyl-ACP dehydratase subunit HadC
- Pfam (hmmscan --cut_ga): FAS1_DH_region PF13452.12 (E=5e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215151.1)
- Domains: Pfam-A via hmmscan --cut_ga — FAS1_DH_region (PF13452.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2030 - Curated reference: UniProt P9WFJ9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
162 functional partner(s); context anchor
hadB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000674|Rv0637|hadC MALKTDIRGMIWRYPDYFIVGREQCREFARAVKCDHPAFFSEEAAADLGYDALVAPLTFVTILAKYVQLDFFRHVDVGMETMQIVQVDQRFVFHKPVLAGDKLWARMDIHSVDERFGADIVVTRNLCTNDDGELVMEAYTTLMGQQGDGSARLKWDKESGQVIRTA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hadC? Email the maintainer — the message is pre-filled with this gene's details.