hadB Family assigned · medium auto-curated
H37Rv Rv0636 · MTBC0 mtbc0_000673 ·
142 aa ·
735946–736374 MTBC0
(+) ·
RefSeq NP_215150.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | (3R)-hydroxyacyl-ACP dehydratase subunit HadB |
|---|---|
| MTBC0 PGAP re-annotation | (3R)-hydroxyacyl-ACP dehydratase subunit HadB |
| Revised (this work) | (3R)-hydroxyacyl-ACP dehydratase subunit HadB. Pfam: MaoC_dehydratas (PF01575.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 15 publications
15 TB publications mention this gene. 15 publication(s) discuss this gene (14 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (5)).
| Publication | Date |
|---|---|
| HadBD dehydratase from Mycobacterium tuberculosis fatty acid synthase type II: A singular structure for a unique function. doi:10.1002/pro.4964 | 2024 |
| 1,3-Diarylpyrazolyl-acylsulfonamides Target HadAB/BC Complex in Mycobacterium tuberculosis. doi:10.1021/acsinfecdis.2c00392 | 2022 |
| Mechanisms of Resistance Associated with the Inhibition of the Dehydration Step of Type II Fatty Acid Synthase in Mycobacterium tuberculosis. doi:10.1021/acsinfecdis.9b00162 | 2020 |
| The Non-Essential Mycolic Acid Biosynthesis Genes hadA and hadC Contribute to the Physiology and Fitness of Mycobacterium smegmatis. doi:10.1371/journal.pone.0145883 | 2015 |
| Evolution of Mycolic Acid Biosynthesis Genes and Their Regulation during Starvation in Mycobacterium tuberculosis. doi:10.1128/JB.00433-15 | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 3 % of gene
| Neighbour | hadA (Rv0635, + strand) |
|---|---|
| Overlap | 14 bp, 3 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -11.98 (95% CI -14.04 to -9.68). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in fatty acid synthesis type II (fas-II) |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0655
· 99.3% identity |
|---|---|
| M. leprae |
ML1909c
· 93.0% identity |
| M. marinum |
MMAR_0969
· 97.2% identity |
| M. smegmatis |
MSMEG_1341
· 85.2% identity |
| M. orygis |
RJtmp_000671
· 100.0% identity |
| M. abscessus |
MAB_3897c
· 83.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6WYY7
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | (3R)-hydroxyacyl-ACP dehydratase subunit HadB |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | hadB |
| eggNOG description | Functions as a heterodimer along with HadA or HadC in fatty acid biosynthesis |
| Orthologous group | COG2030 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.336 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 94.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 56.9% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 8 in the ORF — 7 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.125, mean read count 92. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0636-hadB_TetOn2.1 (TetON promoter 2) |
|---|---|
| Baseline knockdown fitness | 5.03 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1780.0 ppm · rank 106/3519 (97.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 142 aa |
|---|---|
| Molecular weight | 14.9 kDa |
| Theoretical pI | 6.08 |
| GRAVY | 0.02 (hydrophobic) |
| Aliphatic index | 91.3 |
| Aromaticity | 0.07 |
| Instability index | 17.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MaoC_dehydratas | PF01575.26 | 2.0e-29 | 15–126 | MaoC like domain |
Experimental structures (Protein Data Bank) 8 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8y21 |
X-ray diffraction | 1.691 Å | 100% |
4rlj |
X-ray diffraction | 1.75 Å | 100% |
8pwz |
X-ray diffraction | 2.00196723217 Å | 100% |
4rlt |
X-ray diffraction | 2.049 Å | 100% |
4rlw |
X-ray diffraction | 2.196 Å | 100% |
4rlu |
X-ray diffraction | 2.198 Å | 100% |
7svt |
X-ray diffraction | 2.4 Å | 100% |
5zy8 |
X-ray diffraction | 2.899 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (8 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4rlj-assembly1_B |
1.00 | 0.99 | 1.1e-25 sig | 4rlj-assembly1_B Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium tuberculosis |
4rv2-assembly1_B-2 |
1.00 | 0.99 | 6.1e-24 sig | 4rv2-assembly1_B-2 Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium smegmatis |
5i7n-assembly1_A-2 |
1.00 | 0.97 | 2.3e-17 sig | 5i7n-assembly1_A-2 MaoC-like dehydratase |
4v12-assembly1_A-2 |
1.00 | 0.97 | 4.5e-16 sig | 4v12-assembly1_A-2 Crystal structure of the MSMEG_6754 dehydratase from Mycobacterium smegmatis |
1iq6-assembly1_A |
1.00 | 0.88 | 2.3e-09 sig | 1iq6-assembly1_A (R)-HYDRATASE FROM A. CAVIAE INVOLVED IN PHA BIOSYNTHESIS |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 6
| Upstream (5' on genome) | hadA (+ strand, -14 bp gap) |
|---|---|
| Downstream (3' on genome) | hadC (+ strand, 3 bp gap) |
| Predicted operon |
thrT · metT · rpmG2 · hadA · hadB · hadC
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
espR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hadA ((3R)-hydroxyacyl-ACP dehydratase subunit HadA), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0635 hadA exp |
(3R)-hydroxyacyl-ACP dehydratase subunit HadA | 999 | 1000 ctx | neighborhood:882 fusion:760 cooccurence:734 coexpression:800 experimental:999 textmining:484 |
Rv0637 hadC exp |
(3R)-hydroxyacyl-ACP dehydratase subunit HadC | 999 | 1000 ctx | neighborhood:882 cooccurence:756 coexpression:855 experimental:999 textmining:934 |
Rv0504c hyp exp |
hypothetical protein | 999 | 997 ctx | cooccurence:756 experimental:987 textmining:860 |
Rv0733 adk |
adenylate kinase | 837 | 831 | coexpression:830 |
Rv0634B rpmG2 |
50S ribosomal protein L33 | 881 | 820 ctx | neighborhood:811 |
Rv0719 rplF |
50S ribosomal protein L6 | 761 | 761 | coexpression:761 |
Rv0718 rpsH |
30S ribosomal protein S8 | 760 | 759 | coexpression:759 |
Rv1630 rpsA |
30S ribosomal protein S1 | 733 | 734 | coexpression:733 |
Rv1078 pra hyp |
hypothetical protein | 732 | 732 | coexpression:732 |
Rv0715 rplX |
50S ribosomal protein L24 | 730 | 730 | coexpression:730 |
Rv0716 rplE |
50S ribosomal protein L5 | 703 | 703 | coexpression:703 |
Rv3339c icd1 exp |
isocitrate dehydrogenase | 633 | 633 | database:476 |
Rv0632c echA3 |
enoyl-CoA hydratase EchA3 | 638 | 625 | |
Rv3274c fadE25 |
acyl-CoA dehydrogenase | 629 | 612 | |
Rv0640 rplK |
50S ribosomal protein L11 | 566 | 567 ctx | neighborhood:544 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: (3R)-hydroxyacyl-ACP dehydratase subunit HadB
- MTBC0 PGAP product: (3R)-hydroxyacyl-ACP dehydratase subunit HadB
- Pfam (hmmscan --cut_ga): MaoC_dehydratas PF01575.26 (E=2e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215150.1)
- Domains: Pfam-A via hmmscan --cut_ga — MaoC_dehydratas (PF01575.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2030 - Curated reference: UniProt I6WYY7 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
165 functional partner(s); context anchor
hadA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000673|Rv0636|hadB MALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVVGLDTAIAHGMLTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGAELVFNGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAKLA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hadB? Email the maintainer — the message is pre-filled with this gene's details.