hadB Family assigned · medium auto-curated

H37Rv Rv0636 · MTBC0 mtbc0_000673 · 142 aa · 735946–736374 (+) · RefSeq NP_215150.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)(3R)-hydroxyacyl-ACP dehydratase subunit HadB
MTBC0 PGAP re-annotation(3R)-hydroxyacyl-ACP dehydratase subunit HadB
Revised (this work)(3R)-hydroxyacyl-ACP dehydratase subunit HadB. Pfam: MaoC_dehydratas (PF01575.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WYY7 TrEMBL · unreviewed · Evidence at protein level
UniProt name(3R)-hydroxyacyl-ACP dehydratase subunit HadB

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namehadB
eggNOG descriptionFunctions as a heterodimer along with HadA or HadC in fatty acid biosynthesis
Orthologous groupCOG2030

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.336 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MaoC_dehydratasPF01575.26 2.0e-2915–126 MaoC like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hadA ((3R)-hydroxyacyl-ACP dehydratase subunit HadA), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0635 hadA (3R)-hydroxyacyl-ACP dehydratase subunit HadA 999 1000 ctx neighborhood:882 fusion:760 cooccurence:734 coexpression:800 experimental:999 textmining:484
Rv0637 hadC (3R)-hydroxyacyl-ACP dehydratase subunit HadC 999 1000 ctx neighborhood:882 cooccurence:756 coexpression:855 experimental:999 textmining:934
Rv0504c hyp hypothetical protein 999 997 ctx cooccurence:756 experimental:987 textmining:860
Rv0733 adk adenylate kinase 837 831 coexpression:830
Rv0634B rpmG2 50S ribosomal protein L33 881 820 ctx neighborhood:811
Rv0719 rplF 50S ribosomal protein L6 761 761 coexpression:761
Rv0718 rpsH 30S ribosomal protein S8 760 759 coexpression:759
Rv1630 rpsA 30S ribosomal protein S1 733 734 coexpression:733
Rv1078 pra hyp hypothetical protein 732 732 coexpression:732
Rv0715 rplX 50S ribosomal protein L24 730 730 coexpression:730
Rv0716 rplE 50S ribosomal protein L5 703 703 coexpression:703
Rv3339c icd1 isocitrate dehydrogenase 633 633 database:476
Rv0632c echA3 enoyl-CoA hydratase EchA3 638 625
Rv3274c fadE25 acyl-CoA dehydrogenase 629 612
Rv0640 rplK 50S ribosomal protein L11 566 567 ctx neighborhood:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: (3R)-hydroxyacyl-ACP dehydratase subunit HadB
  • MTBC0 PGAP product: (3R)-hydroxyacyl-ACP dehydratase subunit HadB
  • Pfam (hmmscan --cut_ga): MaoC_dehydratas PF01575.26 (E=2e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215150.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MaoC_dehydratas (PF01575.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2030
  • Curated reference: UniProt I6WYY7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 165 functional partner(s); context anchor hadA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000673|Rv0636|hadB
MALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVVGLDTAIAHGMLTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGAELVFNGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAKLA