sodC Family assigned · medium auto-curated

H37Rv Rv0432 · MTBC0 mtbc0_000454 · 240 aa · 522965–523687 (+) · RefSeq NP_214946.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)superoxide dismutase
MTBC0 PGAP re-annotationsuperoxide dismutase family protein
Revised (this work)Superoxide dismutase family protein. Pfam: Sod_Cu (PF00080.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGE9 SwissProt · reviewed · Evidence at protein level
UniProt nameSuperoxide dismutase [Cu-Zn]
EC (curated) EC 1.15.1.1
Curated functionDestroys radicals which are normally produced within the cells and which are toxic to biological systems. May play a role in favoring mycobacterial survival in phagocytes (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namesodC
eggNOG descriptionDestroys radicals which are normally produced within the cells and which are toxic to biological systems
Orthologous groupCOG2032
EC number EC 1.15.1.1
KEGG orthology K04565
KEGG pathways map04146, map04213, map05014, map05016, map05020
Gene Ontology (84) GO:0000302, GO:0000303, GO:0000305, GO:0003674, GO:0003824, GO:0004784, GO:0005575, GO:0005576, GO:0005615, GO:0005618, GO:0005623, GO:0005886 +72 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.146 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Sod_CuPF00080.26 2.0e-2486–237 Copper/zinc superoxide dismutase (SODC)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0433 (carboxylate-amine ligase), high confidence from genomic context alone (score 907 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2876 transmembrane protein 997 998 experimental:997
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 997 997 experimental:997
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 997 997 experimental:997
Rv0433 carboxylate-amine ligase 907 907 ctx neighborhood:882
Rv3043c ctaD cytochrome C oxidase cytochrome 1 907 877 experimental:870
Rv2200c ctaC cytochrome C oxidase subunit II 880 874 experimental:870
Rv2193 ctaE cytochrome C oxidase subunit III 876 872 experimental:870
Rv2194 qcrC ubiquinol-cytochrome C reductase cytochrome subunit C 871 872 experimental:870
Rv2199c ctaF cytochrome c oxidase polypeptide 4 871 872 experimental:870
Rv3846 sodA superoxide dismutase 985 841 experimental:788 textmining:914
Rv0431 tuberculin-like peptide 835 835 ctx neighborhood:833
Rv3584 lpqE lipoprotein LpqE 823 824 experimental:790
Rv0434 hyp hypothetical protein 804 804 ctx neighborhood:801
Rv0430 hyp hypothetical protein 797 797 ctx neighborhood:795
Rv0428c GCN5-like N-acetyltransferase 669 669 ctx neighborhood:664

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: superoxide dismutase
  • MTBC0 PGAP product: superoxide dismutase family protein
  • Pfam (hmmscan --cut_ga): Sod_Cu PF00080.26 (E=2e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214946.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Sod_Cu (PF00080.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2032
  • Curated reference: UniProt P9WGE9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 77 functional partner(s); context anchor Rv0433
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000454|Rv0432|sodC
MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG