Rv3071 Family assigned · low auto-curated · to review

H37Rv Rv3071 · MTBC0 mtbc0_003264 · 369 aa · 3455828–3456937 (+) · RefSeq NP_217587.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF190 domain-containing protein
Revised (this work)DUF190 domain-containing protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt P95087 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF190 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionUncharacterized ACR, COG1993
Orthologous groupCOG1993
KEGG orthology K09137

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.763 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF190PF02641.21 4.5e-21248–343 Uncharacterized ACR, COG1993

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.1 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2dcl-assembly1_C-2 1.00 0.78 1.4e-03 sig 2dcl-assembly1_C-2 Structure of PH1503 protein from Pyrococcus Horikoshii OT3
1o51-assembly1_A 1.00 0.80 6.1e-03 sig 1o51-assembly1_A Crystal structure of a putative PII-like signaling protein (TM0021) from Thermotoga maritima at 2.50 A resolution
5d4o-assembly1_A 0.96 0.61 3.4e-02 5d4o-assembly1_A Structure of CPII, a nitrogen regulatory PII-like protein from Thiomonas intermedia K12, bound to ADP, AMP and bicarbonate.
4iyq-assembly1_C 0.89 0.64 1.6e-01 4iyq-assembly1_C Crystal structure of divalent ion tolerance protein CutA1 from Ehrlichia chaffeensis
1nza-assembly1_A 0.69 0.62 3.6e-01 1nza-assembly1_A Divalent cation tolerance protein (Cut A1) from thermus thermophilus HB8
4zk7-assembly1_M 0.69 0.61 3.8e-01 4zk7-assembly1_M Crystal structure of rescued two-component self-assembling tetrahedral cage T33-31
4e98-assembly1_B 0.63 0.62 4.8e-01 4e98-assembly1_B Crystal structure of possible CutA1 divalent ion tolerance protein from Cryptosporidium parvum Iowa II
6nf8-assembly1_F 0.63 0.56 2.4e-01 6nf8-assembly1_F Structure of human mitochondrial translation initiation factor 3 bound to the small ribosomal subunit -Class I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: crcB (fluoride ion transporter CrcB), high confidence from genomic context alone (score 926 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3069 crcB fluoride ion transporter CrcB 936 926 ctx neighborhood:881 cooccurence:402
Rv3070 crcB fluoride ion transporter CrcB 925 914 ctx neighborhood:881
Rv3413c rsdA anti-sigma-D factor RsdA 689 689 ctx cooccurence:689
Rv3068c pgmA phosphoglucomutase PgmA 654 654 ctx neighborhood:636
Rv0210 hyp hypothetical protein 642 642 ctx cooccurence:611
Rv0441c hyp hypothetical protein 622 623 ctx cooccurence:622
Rv3338 Rv3338, (MTV016.38), len: 214 aa. Hypothetical protein, equivalent to C-termini of Q49926|ML0685 TPEA (putative hydrolase) from Mycobacteriu 607 607 ctx cooccurence:607
Rv2629 hyp hypothetical protein 589 590 ctx cooccurence:587
Rv0493c hyp hypothetical protein 586 587 ctx cooccurence:583
Rv0760c hyp hypothetical protein 562 563 ctx cooccurence:560
Rv1913 hyp hypothetical protein 532 533 ctx cooccurence:528
Rv2721c hyp hypothetical protein 515 515 ctx cooccurence:515
Rv2751 hyp hypothetical protein 509 510 ctx cooccurence:508
Rv2633c hyp hypothetical protein 498 498 ctx cooccurence:495
Rv0479c membrane protein 492 493 ctx cooccurence:490

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF190 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF190 PF02641.21 (E=4e-21)
  • Foldseek best: 2dcl-assembly1_C-2 Structure of PH1503 protein from Pyrococcus Horikoshii OT3 (prob 1.00, E=1e-03, TM=0.78)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217587.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF190 (PF02641.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1993
  • Curated reference: UniProt P95087 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.1, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor crcB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003264|Rv3071|
MNEQCLKLTAYFGERQRAVGGAGRFLADAMLDLFGSHNVATSVMLRGTTSFGPKHEFRCDQSLSLSEDPPVTVAAVDIESKIRSLVDDVTAMTDRGLVTLERARLVTRHSGAEEFGDIDSRNGDAAKLTIYAGRQVRVAGAPAYYTICELLHRHGFAGATVLLGVDGTAHGRRRRARFFGRNVNVPLMIIAVGTPAQVAVAAMELTAALPNPLLTIERVRLCKRDGELFARPQQLPQTDDQGRTLWQKLMVHTAEATHHEGLPIHRALVHRLMQSETARGATALRGIWGFYGDHKPHGDKLFQLVRRVPVTTIIVDTPQAIARSFDIVDELTNWHGLVTSEMVPAAVSLTGSRDGTQKTGETPLARYDY