Rv0433 Resolved · high auto-curated

H37Rv Rv0433 · MTBC0 mtbc0_000455 · 376 aa · 523689–524819 (+) · RefSeq NP_214947.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)carboxylate-amine ligase
MTBC0 PGAP re-annotationglutamate--cysteine ligase
Revised (this work)Glutamate--cysteine ligase. Pfam: GCS2 (PF04107.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPK9 SwissProt · reviewed · Evidence at protein level
UniProt namePutative glutamate--cysteine ligase 2
EC (curated) EC 6.3.2.2
Curated functionATP-dependent carboxylate-amine ligase which exhibits weak glutamate--cysteine ligase activity.

UniProt still lists this protein as Putative glutamate--cysteine ligase 2; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred nameybdK
eggNOG descriptionATP-dependent carboxylate-amine ligase which exhibits weak glutamate--cysteine ligase activity
Orthologous groupCOG2170
KEGG orthology K06048

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.163 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GCS2PF04107.19 7.0e-11819–368 Glutamate-cysteine ligase family 2(GCS2)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sodC (superoxide dismutase), high confidence from genomic context alone (score 907 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0773c ggtA bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase 932 909 database:900
Rv0432 sodC superoxide dismutase 907 907 ctx neighborhood:882
Rv2394 ggtB gamma-glutamyltranspeptidase precursor GgtB 930 906 database:900
Rv3704c gshA glutamate--cysteine ligase 903 903 database:900
Rv2467 pepN aminopeptidase PepN 910 901 database:900
Rv2213 pepB cytosol aminopeptidase 900 901 database:900
Rv0266c oplA 5-oxoprolinase OplA 900 900 database:900
Rv2411c hyp hypothetical protein 876 876 ctx fusion:868
Rv0431 tuberculin-like peptide 835 835 ctx neighborhood:833
Rv0434 hyp hypothetical protein 827 827 ctx neighborhood:801
Rv0430 hyp hypothetical protein 822 822 ctx neighborhood:795
Rv1187 rocA pyrroline-5-carboxylate dehydrogenase RocA 809 810 database:800
Rv2334 cysK1 O-acetylserine sulfhydrylase 808 809 database:800
Rv2476c gdh NAD-dependent glutamate dehydrogenase 808 809 database:800
Rv2222c glnA2 glutamine synthetase 804 804 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: carboxylate-amine ligase
  • MTBC0 PGAP product: glutamate--cysteine ligase
  • Pfam (hmmscan --cut_ga): GCS2 PF04107.19 (E=7e-118)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214947.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GCS2 (PF04107.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2170
  • Curated reference: UniProt P9WPK9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor sodC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000455|Rv0433|
MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIAEIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHPFARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPHLLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDHMDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMPPWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVSDIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI