Rv0433 Resolved · high auto-curated

H37Rv Rv0433 · MTBC0 mtbc0_000455 · 376 aa · 523689–524819 MTBC0 (+) · RefSeq NP_214947.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)carboxylate-amine ligase
MTBC0 PGAP re-annotationglutamate--cysteine ligase
Revised (this work)Glutamate--cysteine ligase. Pfam: GCS2 (PF04107.19).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
The Mycobacterium tuberculosis mycothiol S-transferase is divalent metal-dependent for mycothiol binding and transfer. doi:10.1039/d2md00401a 2023

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.41 (95% CI -2.37 to 3.99). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown
Mycobrowser EC 6.3.-.- · superseded EC numbering; the atlas uses the current class (6.3.2.2)

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0441 · 99.7% identity
M. marinum MMAR_0748 · 87.1% identity
M. smegmatis MSMEG_0836 · 83.7% identity
M. orygis RJtmp_000454 · 99.7% identity
M. abscessus MAB_4183c · 78.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WPK9 SwissProt · reviewed · Evidence at protein level
UniProt namePutative glutamate--cysteine ligase 2
EC (curated) EC 6.3.2.2
Curated functionATP-dependent carboxylate-amine ligase which exhibits weak glutamate--cysteine ligase activity.

UniProt still lists this protein as Putative glutamate--cysteine ligase 2; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred nameybdK
eggNOG descriptionATP-dependent carboxylate-amine ligase which exhibits weak glutamate--cysteine ligase activity
Orthologous groupCOG2170
KEGG orthology K06048

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.163 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.109 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 87.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 61.4%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 24 in the ORF — 0 in the essential state, 0 growth-defect, 24 non-essential, 0 growth-advantage. Saturation 0.958, mean read count 112.347826087. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.340.0 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 13 of 16 independent MS datasets
Integrated abundance136.0 ppm · rank 1072/3519 (69.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length376 aa
Molecular weight42.3 kDa
Theoretical pI5.57
GRAVY-0.201 (hydrophilic)
Aliphatic index93.7
Aromaticity0.074
Instability index41.2 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GCS2PF04107.19 7.0e-11819–368 Glutamate-cysteine ligase family 2(GCS2)

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.0

PDB hitprobTM-scoreE-valueDescription
1tt4-assembly1_B 1.00 0.92 1.2e-24 sig 1tt4-assembly1_B Structure of NP459575, a predicted glutathione synthase from Salmonella typhimurium
1r8g-assembly1_B 1.00 0.91 5.3e-25 sig 1r8g-assembly1_B Structure and function of YbdK
1r8g-assembly1_A 1.00 0.90 1.0e-24 sig 1r8g-assembly1_A Structure and function of YbdK
2gwc-assembly1_B 1.00 0.76 1.1e-14 sig 2gwc-assembly1_B Crystal structure of plant glutamate cysteine ligase in complex with a transition state analogue
3nzt-assembly1_A 1.00 0.67 1.8e-09 sig 3nzt-assembly1_A 2.0 Angstrom Crystal structure of Glutamate--Cysteine Ligase (gshA) ftom Francisella tularensis in Complex with AMP

Foldseek search of the AlphaFold DB model (mean pLDDT 95.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 4

Upstream (5' on genome)sodC (+ strand, 1 bp gap)
Downstream (3' on genome)Rv0434 (+ strand, 59 bp gap)
Predicted operon Rv0430 · Rv0431 · sodC · Rv0433

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: sodC (superoxide dismutase), high confidence from genomic context alone (score 907 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0773c ggtA exp bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase 932 909 database:900
Rv0432 sodC superoxide dismutase 907 907 ctx neighborhood:882
Rv2394 ggtB exp gamma-glutamyltranspeptidase precursor GgtB 930 906 database:900
Rv3704c gshA exp glutamate--cysteine ligase 903 903 database:900
Rv2467 pepN exp aminopeptidase PepN 910 901 database:900
Rv2213 pepB exp cytosol aminopeptidase 900 901 database:900
Rv0266c oplA exp 5-oxoprolinase OplA 900 900 database:900
Rv2411c hyp hypothetical protein 876 876 ctx fusion:868
Rv0431 tuberculin-like peptide 835 835 ctx neighborhood:833
Rv0434 hyp hypothetical protein 827 827 ctx neighborhood:801
Rv0430 hyp hypothetical protein 822 822 ctx neighborhood:795
Rv1187 rocA exp pyrroline-5-carboxylate dehydrogenase RocA 809 810 database:800
Rv2334 cysK1 exp O-acetylserine sulfhydrylase 808 809 database:800
Rv2476c gdh exp NAD-dependent glutamate dehydrogenase 808 809 database:800
Rv2222c glnA2 exp glutamine synthetase 804 804 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: carboxylate-amine ligase
  • MTBC0 PGAP product: glutamate--cysteine ligase
  • Pfam (hmmscan --cut_ga): GCS2 PF04107.19 (E=7e-118)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214947.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GCS2 (PF04107.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2170
  • Curated reference: UniProt P9WPK9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor sodC
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000455|Rv0433|
MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIAEIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHPFARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPHLLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDHMDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMPPWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVSDIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI