PPE10 Family assigned · medium auto-curated
H37Rv Rv0442c · MTBC0 - ·
487 aa ·
530751–532214 H37Rv
(-) ·
RefSeq YP_177726.2
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PPE family protein PPE10 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PPE family protein PPE10. Pfam: PPE (PF00823.26), Pentapeptide_2 (PF01469.25). |
| Functional category (TubercuList) | PE/PPE |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (2 in a M. tuberculosis context, 2 in other mycobacteria — M. marinum (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| Mycobacterium tuberculosis PPE10 (Rv0442c) alters host cell apoptosis and cytokine profile via linear ubiquitin chain assembly complex HOIP-NF-κB signaling axis. doi:10.1016/j.intimp.2020.107363 | 2021 |
| RD5-mediated lack of PE_PGRS and PPE-MPTR export in BCG vaccine strains results in strong reduction of antigenic repertoire but little impact on protection. doi:10.1371/journal.ppat.1007139 | 2018 |
| The ESX-5 System of Pathogenic Mycobacteria Is Involved In Capsule Integrity and Virulence through Its Substrate PPE10. doi:10.1371/journal.ppat.1005696 | 2016 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 58% of residues (metapredict) · mean AlphaFold pLDDT 73.6 |
|---|---|
| Disordered regions | 1 IDR(s), longest 280 aa [207-487] |
sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 1.14 (95% CI -1.78 to 4.89). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0450c
· 99.8% identity |
|---|---|
| M. marinum |
MMAR_0761
· 77.2% identity |
| M. orygis |
RJtmp_000463
· 99.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WI41
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PPE family protein PPE10 |
| Curated function | Plays a major role in the integrity and stability of the capsule. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PPE family |
| Orthologous group | COG5651 |
| Gene Ontology (25) |
GO:0008150, GO:0009605, GO:0009607, GO:0020012, GO:0030682, GO:0042783, GO:0043207, GO:0044403, GO:0044413, GO:0044415, GO:0044419, GO:0050896 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 1.533 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 8 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 9.96% of strains (14470) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.227 (low power)
· 7 consensus substitution(s) low power (7 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 2/53 (4%) · mean identity 76.4%
· 1/4 closest MTBAP relatives present in a subset of the genus (2/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 25 in the ORF — 0 in the essential state, 0 growth-defect, 25 non-essential, 0 growth-advantage. Saturation 0.920, mean read count 139.695652174. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 4 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 5.65 ppm · rank 2897/3519 (17.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 487 aa |
|---|---|
| Molecular weight | 47.2 kDa |
| Theoretical pI | 4.5 |
| GRAVY | 0.062 (hydrophobic) |
| Aliphatic index | 75.6 |
| Aromaticity | 0.062 |
| Instability index | 29.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PPE | PF00823.26 | 1.7e-58 | 5–168 | PPE family |
Pentapeptide_2 | PF01469.25 | 3.9e-09 | 218–256 | Pentapeptide repeats (8 copies) |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 73.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5xfs-assembly1_B |
1.00 | 0.94 | 4.6e-12 sig | 5xfs-assembly1_B Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis |
4w4l-assembly1_B |
1.00 | 0.84 | 1.2e-09 sig | 4w4l-assembly1_B Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis |
6vj5-assembly1_B |
1.00 | 0.84 | 6.0e-09 sig | 6vj5-assembly1_B Structure of PE25-PPE41(A124L) in complex with EspG5 chaperone from the type VII (ESX-5) secretion system |
6uuj-assembly2_E |
1.00 | 0.86 | 1.6e-08 sig | 6uuj-assembly2_E Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121 |
6uuj-assembly3_H |
1.00 | 0.85 | 2.3e-08 sig | 6uuj-assembly3_H Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121 |
Foldseek search of the AlphaFold DB model (mean pLDDT 73.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0441c (- strand, 26 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0443 (+ strand, 181 bp gap) |
| Predicted operon |
Rv0441c · PPE10
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
mftR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: PE_PGRS28 (PE-PGRS family protein PE_PGRS28), high confidence from genomic context alone (score 772 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0441c hyp |
hypothetical protein | 918 | 885 ctx | neighborhood:846 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 772 | 772 ctx | cooccurence:772 |
Rv2209 |
integral membrane protein | 771 | 771 ctx | cooccurence:768 |
Rv1004c |
membrane protein | 770 | 771 ctx | cooccurence:768 |
Rv2082 hyp |
hypothetical protein | 770 | 771 ctx | cooccurence:769 |
Rv0872c PE_PGRS15 |
PE-PGRS family protein PE_PGRS15 | 770 | 770 ctx | cooccurence:770 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 785 | 769 ctx | cooccurence:769 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 768 | 768 ctx | cooccurence:768 |
Rv3864 espE |
ESX-1 secretion-associated protein EspE | 768 | 768 ctx | cooccurence:762 |
Rv3903c cpnT hyp |
hypothetical protein | 767 | 768 ctx | cooccurence:731 |
Rv0341 iniB |
isoniazid inducible protein IniB | 764 | 764 ctx | cooccurence:762 |
Rv2853 PE_PGRS48 |
PE-PGRS family protein PE_PGRS48 | 764 | 764 ctx | cooccurence:764 |
Rv0124 PE_PGRS2 |
PE-PGRS family protein PE_PGRS2 | 762 | 762 ctx | cooccurence:762 |
Rv2942 mmpL7 |
transmembrane transport protein MmpL7 | 758 | 758 ctx | cooccurence:756 |
Rv3879c espK |
ESX-1 secretion-associated protein EspK | 755 | 755 ctx | cooccurence:755 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE10
- Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=2e-58), Pentapeptide_2 PF01469.25 (E=4e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177726.2)
- Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26), Pentapeptide_2 (PF01469.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5651 - Curated reference: UniProt P9WI41 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 73.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
93 functional partner(s); context anchor
PE_PGRS28 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0442c|PPE10 MTSPHFAWLPPEINSALMFAGPGSGPLIAAATAWGELAEELLASIASLGSVTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAALAATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASAAVAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGSGNTGSGNLGLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGNVGLFNSGSGNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGSEAALVSSAGYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAPVGGLDSGNPNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGSGIPKSNFYPSPDRESAYASPRIGQPVGSE
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for PPE10? Email the maintainer — the message is pre-filled with this gene's details.