Rv0446c Family assigned · medium auto-curated

H37Rv Rv0446c · MTBC0 mtbc0_000468 · 256 aa · 537810–538580 (-) · RefSeq NP_214960.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF1295 domain-containing protein
Revised (this work)DUF1295 domain-containing protein. Pfam: DUF1295 (PF06966.18), PEMT (PF04191.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53731 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
eggNOG descriptionProtein of unknown function (DUF1295)
Orthologous groupCOG2020

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.468 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 10.27% of strains (14916) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1295PF06966.18 6.9e-8117–243 Protein of unknown function (DUF1295)
PEMTPF04191.19 2.9e-05132–218 Phospholipid methyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ufaA1 (cyclopropane-fatty-acyl-phospholipid synthase UfaA), high confidence from genomic context alone (score 946 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0449c hyp hypothetical protein 982 983 ctx neighborhood:803 fusion:635 cooccurence:763
Rv0448c hyp hypothetical protein 971 972 ctx neighborhood:882 cooccurence:767
Rv0447c ufaA1 cyclopropane-fatty-acyl-phospholipid synthase UfaA 945 946 ctx neighborhood:882 cooccurence:538
Rv0445c sigK ECF RNA polymerase sigma factor SigK 763 763 ctx neighborhood:694
Rv0444c rskA anti-sigma-K factor RskA 673 673 ctx neighborhood:593
Rv0450c mmpL4 transmembrane transport protein MmpL4 534 534 ctx neighborhood:533
Rv0451c mmpS4 membrane protein MmpS4 509 510 ctx neighborhood:508
Rv0885 hyp hypothetical protein 478 150 textmining:412
Rv3355c integral membrane protein 657 55 textmining:652
Rv1855c oxidoreductase 643 50 textmining:640
Rv3346c transmembrane protein 614 47 textmining:612
Rv3049c monooxygenase 492 47 textmining:489
Rv3675 membrane protein 514 41 textmining:514
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: DUF1295 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF1295 PF06966.18 (E=7e-81), PEMT PF04191.19 (E=3e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214960.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1295 (PF06966.18), PEMT (PF04191.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2020
  • Curated reference: UniProt O53731 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor ufaA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000468|Rv0446c|
MVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAVAVAAATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQALRKVFGLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVFKSDPANRGVIMDRGLWAWTRHPNYFGDACVWWGLWLITINDWAPLATVGSPLLMTYLLVDVSGARLTERYLKGRPGFAEYQRRTAYFVPRPPRSARR