ufaA1 Resolved · high auto-curated
H37Rv Rv0447c · MTBC0 mtbc0_000469 ·
427 aa ·
538589–539872 MTBC0
(-) ·
RefSeq NP_214961.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cyclopropane-fatty-acyl-phospholipid synthase UfaA |
|---|---|
| MTBC0 PGAP re-annotation | class I SAM-dependent methyltransferase |
| Revised (this work) | Class I SAM-dependent methyltransferase. Pfam: CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (6 in a M. tuberculosis context).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv0448c (Rv0448c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
SigK (sigK).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.55 (95% CI -1.96 to 6.26). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Transfers a methylene group from S-adenosyl-L-methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge [catalytic activity: S-adenosyl-L-methionine + phospholipid olefinic fatty acid = S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid]. |
|---|---|
| Mycobrowser EC |
2.1.1.79
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0455c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0768
· 72.4% identity |
| M. orygis |
RJtmp_000468
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53732
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Tuberculostearic acid methyltransferase UfaA1 |
| EC (curated) |
EC 2.1.1.-
|
| Curated function | Involved in the biosynthesis of the tuberculostearic acid (10-methylstearic-acid or TSA), a constituent lipid of the mycobacterial cell wall. Catalyzes the transfer of the methyl group from S-adenosyl-L-methionine (SAM) to the double bond of oleic acid in phosphatidylethanolamine or phosphatidylcholine to produce TSA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | ufaA1 |
| eggNOG description | Transfers a methylene group from S-adenosyl-L- methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge catalytic activity S-adenosyl-L- methionine phospholipid olefinic fatty acid S-adenosyl- L-homocysteine phospholipid cyclopropane fatty acid |
| Orthologous group | COG2230 |
| EC number |
EC 2.1.1.79
|
| KEGG orthology |
K00574
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.212 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 39/53 (74%) · mean identity 62.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 39/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 44.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 27 in the ORF — 0 in the essential state, 0 growth-defect, 27 non-essential, 0 growth-advantage. Saturation 0.963, mean read count 195.653846154. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Physico-chemical properties (computed, ProtParam)
| Length | 427 aa |
|---|---|
| Molecular weight | 47.8 kDa |
| Theoretical pI | 8.97 |
| GRAVY | -0.188 (hydrophilic) |
| Aliphatic index | 89.2 |
| Aromaticity | 0.089 |
| Instability index | 43.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CMAS | PF02353.27 | 4.6e-102 | 140–419 | Mycolic acid cyclopropane synthetase |
Methyltransf_23 | PF13489.13 | 5.7e-10 | 194–320 | Methyltransferase domain |
Methyltransf_25 | PF13649.13 | 5.7e-11 | 212–305 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 2.5e-08 | 213–308 | Methyltransferase domain |
Methyltransf_12 | PF08242.19 | 6.4e-08 | 213–306 | Methyltransferase domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6bqc-assembly1_A-2 |
1.00 | 0.87 | 5.4e-26 sig | 6bqc-assembly1_A-2 Cyclopropane fatty acid synthase from E. coli |
1kpg-assembly3_C |
1.00 | 0.86 | 2.6e-21 sig | 1kpg-assembly3_C Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB |
1tpy-assembly1_A |
1.00 | 0.86 | 1.1e-20 sig | 1tpy-assembly1_A Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis |
1l1e-assembly2_B |
1.00 | 0.91 | 8.4e-19 sig | 1l1e-assembly2_B Crystal Structure of Mycolic Acid Cyclopropane Synthase PcaA Complexed with S-adenosyl-L-homocysteine |
1l1e-assembly1_A |
1.00 | 0.87 | 1.6e-18 sig | 1l1e-assembly1_A Crystal Structure of Mycolic Acid Cyclopropane Synthase PcaA Complexed with S-adenosyl-L-homocysteine |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | Rv0446c (- strand, 8 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0448c (- strand, -4 bp gap) |
| Predicted operon |
rskA · sigK · Rv0446c · ufaA1 · Rv0448c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
whiA (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv0446c (transmembrane protein), high confidence from genomic context alone (score 946 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0449c hyp |
hypothetical protein | 996 | 996 ctx | neighborhood:803 fusion:899 cooccurence:756 |
Rv0448c hyp |
hypothetical protein | 993 | 993 ctx | neighborhood:882 fusion:714 cooccurence:750 |
Rv0446c |
transmembrane protein | 945 | 946 ctx | neighborhood:882 cooccurence:538 |
Rv3840 |
transcriptional regulator | 740 | 741 | coexpression:735 |
Rv0445c sigK |
ECF RNA polymerase sigma factor SigK | 749 | 738 ctx | neighborhood:696 |
Rv3183 higA3 |
transcriptional regulator | 733 | 733 | coexpression:733 |
Rv3263 |
DNA methylase | 733 | 733 | coexpression:733 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 732 | 733 | coexpression:732 |
Rv0339c iniR |
transcriptional regulator | 730 | 730 | coexpression:730 |
Rv1675c cmr |
HTH-type transcriptional regulator Cmr | 687 | 687 | coexpression:687 |
Rv0444c rskA |
anti-sigma-K factor RskA | 619 | 617 ctx | neighborhood:611 |
Rv0450c mmpL4 |
transmembrane transport protein MmpL4 | 535 | 535 ctx | neighborhood:533 |
Rv0451c mmpS4 |
membrane protein MmpS4 | 509 | 510 ctx | neighborhood:508 |
Rv3720 |
fatty acid synthase | 400 | 400 | |
Rv0469 umaA |
mycolic acid synthase UmaA | 459 | 302 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cyclopropane-fatty-acyl-phospholipid synthase UfaA
- MTBC0 PGAP product: class I SAM-dependent methyltransferase
- Pfam (hmmscan --cut_ga): CMAS PF02353.27 (E=5e-102), Methyltransf_23 PF13489.13 (E=6e-10), Methyltransf_25 PF13649.13 (E=6e-11), Methyltransf_11 PF08241.19 (E=2e-08), Methyltransf_12 PF08242.19 (E=6e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214961.1)
- Domains: Pfam-A via hmmscan --cut_ga — CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2230 - Curated reference: UniProt O53732 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv0446c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000469|Rv0447c|ufaA1 MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTATHLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKELTRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAFLDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGELCIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEMIEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLPSTQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWELYLAYSEAGFRSGYLDVYQWTLIREGPP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ufaA1? Email the maintainer — the message is pre-filled with this gene's details.