ufaA1 Resolved · high auto-curated

H37Rv Rv0447c · MTBC0 mtbc0_000469 · 427 aa · 538589–539872 (-) · RefSeq NP_214961.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclopropane-fatty-acyl-phospholipid synthase UfaA
MTBC0 PGAP re-annotationclass I SAM-dependent methyltransferase
Revised (this work)Class I SAM-dependent methyltransferase. Pfam: CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53732 SwissProt · reviewed · Evidence at protein level
UniProt nameTuberculostearic acid methyltransferase UfaA1
EC (curated) EC 2.1.1.-
Curated functionInvolved in the biosynthesis of the tuberculostearic acid (10-methylstearic-acid or TSA), a constituent lipid of the mycobacterial cell wall. Catalyzes the transfer of the methyl group from S-adenosyl-L-methionine (SAM) to the double bond of oleic acid in phosphatidylethanolamine or phosphatidylcholine to produce TSA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred nameufaA1
eggNOG descriptionTransfers a methylene group from S-adenosyl-L- methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge catalytic activity S-adenosyl-L- methionine phospholipid olefinic fatty acid S-adenosyl- L-homocysteine phospholipid cyclopropane fatty acid
Orthologous groupCOG2230
EC number EC 2.1.1.79
KEGG orthology K00574

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.212 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMASPF02353.27 4.6e-102140–419 Mycolic acid cyclopropane synthetase
Methyltransf_23PF13489.13 5.7e-10194–320 Methyltransferase domain
Methyltransf_25PF13649.13 5.7e-11212–305 Methyltransferase domain
Methyltransf_11PF08241.19 2.5e-08213–308 Methyltransferase domain
Methyltransf_12PF08242.19 6.4e-08213–306 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0446c (transmembrane protein), high confidence from genomic context alone (score 946 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0449c hyp hypothetical protein 996 996 ctx neighborhood:803 fusion:899 cooccurence:756
Rv0448c hyp hypothetical protein 993 993 ctx neighborhood:882 fusion:714 cooccurence:750
Rv0446c transmembrane protein 945 946 ctx neighborhood:882 cooccurence:538
Rv3840 transcriptional regulator 740 741 coexpression:735
Rv0445c sigK ECF RNA polymerase sigma factor SigK 749 738 ctx neighborhood:696
Rv3183 higA3 transcriptional regulator 733 733 coexpression:733
Rv3263 DNA methylase 733 733 coexpression:733
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 732 733 coexpression:732
Rv0339c iniR transcriptional regulator 730 730 coexpression:730
Rv1675c cmr HTH-type transcriptional regulator Cmr 687 687 coexpression:687
Rv0444c rskA anti-sigma-K factor RskA 619 617 ctx neighborhood:611
Rv0450c mmpL4 transmembrane transport protein MmpL4 535 535 ctx neighborhood:533
Rv0451c mmpS4 membrane protein MmpS4 509 510 ctx neighborhood:508
Rv3720 fatty acid synthase 400 400
Rv0469 umaA mycolic acid synthase UmaA 459 302

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cyclopropane-fatty-acyl-phospholipid synthase UfaA
  • MTBC0 PGAP product: class I SAM-dependent methyltransferase
  • Pfam (hmmscan --cut_ga): CMAS PF02353.27 (E=5e-102), Methyltransf_23 PF13489.13 (E=6e-10), Methyltransf_25 PF13649.13 (E=6e-11), Methyltransf_11 PF08241.19 (E=2e-08), Methyltransf_12 PF08242.19 (E=6e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214961.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2230
  • Curated reference: UniProt O53732 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv0446c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000469|Rv0447c|ufaA1
MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTATHLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKELTRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAFLDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGELCIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEMIEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLPSTQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWELYLAYSEAGFRSGYLDVYQWTLIREGPP