ufaA1 Resolved · high auto-curated
H37Rv Rv0447c · MTBC0 mtbc0_000469 ·
427 aa · 538589–539872 (-) ·
RefSeq NP_214961.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cyclopropane-fatty-acyl-phospholipid synthase UfaA |
|---|---|
| MTBC0 PGAP re-annotation | class I SAM-dependent methyltransferase |
| Revised (this work) | Class I SAM-dependent methyltransferase. Pfam: CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53732
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Tuberculostearic acid methyltransferase UfaA1 |
| EC (curated) |
EC 2.1.1.-
|
| Curated function | Involved in the biosynthesis of the tuberculostearic acid (10-methylstearic-acid or TSA), a constituent lipid of the mycobacterial cell wall. Catalyzes the transfer of the methyl group from S-adenosyl-L-methionine (SAM) to the double bond of oleic acid in phosphatidylethanolamine or phosphatidylcholine to produce TSA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | ufaA1 |
| eggNOG description | Transfers a methylene group from S-adenosyl-L- methionine to the cis double bond of an unsaturated fatty acid chain resulting in the replacement of the double bond with a methylene bridge catalytic activity S-adenosyl-L- methionine phospholipid olefinic fatty acid S-adenosyl- L-homocysteine phospholipid cyclopropane fatty acid |
| Orthologous group | COG2230 |
| EC number |
EC 2.1.1.79
|
| KEGG orthology |
K00574
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.212 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CMAS | PF02353.27 | 4.6e-102 | 140–419 | Mycolic acid cyclopropane synthetase |
Methyltransf_23 | PF13489.13 | 5.7e-10 | 194–320 | Methyltransferase domain |
Methyltransf_25 | PF13649.13 | 5.7e-11 | 212–305 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 2.5e-08 | 213–308 | Methyltransferase domain |
Methyltransf_12 | PF08242.19 | 6.4e-08 | 213–306 | Methyltransferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0446c (transmembrane protein), high confidence from genomic context alone (score 946 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0449c hyp |
hypothetical protein | 996 | 996 ctx | neighborhood:803 fusion:899 cooccurence:756 |
Rv0448c hyp |
hypothetical protein | 993 | 993 ctx | neighborhood:882 fusion:714 cooccurence:750 |
Rv0446c |
transmembrane protein | 945 | 946 ctx | neighborhood:882 cooccurence:538 |
Rv3840 |
transcriptional regulator | 740 | 741 | coexpression:735 |
Rv0445c sigK |
ECF RNA polymerase sigma factor SigK | 749 | 738 ctx | neighborhood:696 |
Rv3183 higA3 |
transcriptional regulator | 733 | 733 | coexpression:733 |
Rv3263 |
DNA methylase | 733 | 733 | coexpression:733 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 732 | 733 | coexpression:732 |
Rv0339c iniR |
transcriptional regulator | 730 | 730 | coexpression:730 |
Rv1675c cmr |
HTH-type transcriptional regulator Cmr | 687 | 687 | coexpression:687 |
Rv0444c rskA |
anti-sigma-K factor RskA | 619 | 617 ctx | neighborhood:611 |
Rv0450c mmpL4 |
transmembrane transport protein MmpL4 | 535 | 535 ctx | neighborhood:533 |
Rv0451c mmpS4 |
membrane protein MmpS4 | 509 | 510 ctx | neighborhood:508 |
Rv3720 |
fatty acid synthase | 400 | 400 | |
Rv0469 umaA |
mycolic acid synthase UmaA | 459 | 302 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cyclopropane-fatty-acyl-phospholipid synthase UfaA
- MTBC0 PGAP product: class I SAM-dependent methyltransferase
- Pfam (hmmscan --cut_ga): CMAS PF02353.27 (E=5e-102), Methyltransf_23 PF13489.13 (E=6e-10), Methyltransf_25 PF13649.13 (E=6e-11), Methyltransf_11 PF08241.19 (E=2e-08), Methyltransf_12 PF08242.19 (E=6e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214961.1)
- Domains: Pfam-A via hmmscan --cut_ga — CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2230 - Curated reference: UniProt O53732 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv0446c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000469|Rv0447c|ufaA1 MTVETSQTPSAAIDSDRWPAVAKVPRGPLAAASAAIANRLLRRTATHLPLRLVYSDGTATGAADPRAPSLFIHRPDALARRIGRHGLIGFGESYMAGEWSSKELTRVLTVLAGSVDELVPRSLHWLRPITPTFRPSWPDHSRDQARRNIAVHYDLSNDLFAAFLDETMTYSCAMFTDLLAQPTPAWTELAAAQRRKIDRLLDVAGVQQGSHVLEIGTGWGELCIRAAARGAHIRSVTLSVEQQRLARQRVAAAGFGHRVEIDLCDYRDVDGQYDSVVSVEMIEAVGYRSWPRYFAALEQLVRPGGPVAIQAITMPHHRMLATRHTQTWIQKYIFPGGLLPSTQAIIDITGQHTGLRIVDAASLRPHYAETLRLWRERFMQRRDGLAHLGFDEVFARMWELYLAYSEAGFRSGYLDVYQWTLIREGPP