psd Resolved · high auto-curated

H37Rv Rv0437c · MTBC0 mtbc0_000459 · 231 aa · 528752–529447 (-) · RefSeq NP_214951.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphatidylserine decarboxylase
MTBC0 PGAP re-annotationphosphatidylserine decarboxylase
Revised (this work)Phosphatidylserine decarboxylase. Pfam: PS_Dcarbxylase (PF02666.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHQ5 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphatidylserine decarboxylase proenzyme
EC (curated) EC 4.1.1.65
Curated functionCatalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namepsd
eggNOG descriptionCatalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer)
Orthologous groupCOG0688
EC number EC 4.1.1.65
KEGG orthology K01613
KEGG pathways map00564, map01100, map01110
KEGG modules M00093
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.077 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PS_DcarbxylasePF02666.21 4.6e-4257–227 Phosphatidylserine decarboxylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pssA (CDP-diacylglycerol--serine O-phosphatidyltransferase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0436c pssA CDP-diacylglycerol--serine O-phosphatidyltransferase 999 998 ctx neighborhood:881 cooccurence:766 database:900 textmining:591
Rv2351c plcA membrane-associated phospholipase A 900 900 database:900
Rv1755c plcD Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below),highly similar to C-terminus o 900 900 database:900
Rv2350c plcB membrane-associated phospholipase B 900 900 database:900
Rv2349c plcC phospholipase C 900 900 database:900
Rv0435c ATPase 888 884 ctx neighborhood:881
Rv0438c moeA2 molybdopterin molybdenumtransferase 807 807 ctx neighborhood:802
Rv1279 GMC-type oxidoreductase 808 801 database:800
Rv0439c dehydrogenase/reductase 632 618 ctx neighborhood:613
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 605 605
Rv0906 hyp hypothetical protein 469 469
Rv1383 carA carbamoyl-phosphate synthase small subunit 432 433 coexpression:427
Rv1382 hyp hypothetical protein 423 423 coexpression:419
Rv2612c pgsA1 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 656 337 textmining:503
Rv2746c pgsA3 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 712 335 textmining:586

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphatidylserine decarboxylase
  • MTBC0 PGAP product: phosphatidylserine decarboxylase
  • Pfam (hmmscan --cut_ga): PS_Dcarbxylase PF02666.21 (E=5e-42)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214951.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PS_Dcarbxylase (PF02666.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0688
  • Curated reference: UniProt P9WHQ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor pssA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000459|Rv0437c|psd
MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRYRWLRGTGLLAAAACAGFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPLPRVSIFLSILDAHVQRAPVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCDAHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVAGETVLAECR