ubiA Resolved · high auto-curated

H37Rv Rv3806c · MTBC0 mtbc0_004034 · 302 aa · 4293035–4293943 (-) · RefSeq NP_218323.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)decaprenyl-phosphate phosphoribosyltransferase
MTBC0 PGAP re-annotationdecaprenyl-phosphate phosphoribosyltransferase
Revised (this work)Decaprenyl-phosphate phosphoribosyltransferase. Pfam: UbiA (PF01040.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFR5 SwissProt · reviewed · Evidence at protein level
UniProt nameDecaprenyl-phosphate phosphoribosyltransferase
EC (curated) EC 2.4.2.45
Curated functionInvolved in the biosynthesis of decaprenylphosphoryl arabinose (DPA) a precursor for arabinan synthesis in mycobacterial cell wall biosynthesis. Catalyzes the transfer of a 5-phosphoribosyl residue from phosphoribose diphosphate (PRPP) to decaprenyl phosphate (DP) to form decaprenylphosphoryl-5-phosphoribose (DPPR). The enzyme favors polyprenyl phosphate with 50-60 carbon atoms, is unable to use C-20 polyprenyl phosphate, and uses C-75 polyprenyl phosphate less efficiently than C-50 or C-60. Cannot use UDP-galactose or GDP-mannose as a sugar donor. May play a role in ethambutol (EMB) resistanc.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred nameubiA
eggNOG descriptionCatalyzes the formation of decaprenylphosphoryl-5-phosphoribose from phosphoribose diphosphate and decaprenyl phosphate
Orthologous groupCOG0382
EC number EC 2.4.2.45
KEGG orthology K14136
Gene Ontology (43) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0006629, GO:0006643, GO:0006664, GO:0008150 +31 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.637 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UbiAPF01040.24 1.8e-2153–265 UbiA prenyltransferase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3807c (decaprenylphosphoryl-5-phosphoribose phosphatase), high confidence from genomic context alone (score 970 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3807c decaprenylphosphoryl-5-phosphoribose phosphatase 994 970 ctx neighborhood:882 database:500 textmining:818
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 981 968 ctx neighborhood:780 coexpression:801 textmining:464
Rv3808c glfT2 galactofuranosyl transferase GlfT 970 963 ctx neighborhood:843 coexpression:772
Rv3790 dprE1 decaprenylphosphoryl-beta-D-ribose oxidase 965 899 ctx cooccurence:774 database:552 textmining:675
Rv3809c glf UDP-galactopyranose mutase 880 847 ctx neighborhood:843
Rv1614 lgt prolipoprotein diacylglyceryl transferase 808 808 coexpression:797
Rv1797 eccE5 ESX-5 type VII secretion system protein EccE 797 797 coexpression:797
Rv3791 dprE2 decaprenylphosphoryl-D-2-keto erythropentose reductase 896 788 ctx cooccurence:773 textmining:531
Rv2073c oxidoreductase 794 786 ctx cooccurence:772
Rv0513 transmembrane protein 783 783 coexpression:783
Rv1310 atpD ATP synthase subunit beta 791 781 database:731
Rv0176 Mce associated transmembrane protein 780 780 coexpression:780
Rv0178 Mce associated membrane protein 773 773 coexpression:746
Rv3789 GtrA family protein 798 756 ctx cooccurence:742
Rv1836c hyp hypothetical protein 777 754 coexpression:752

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: decaprenyl-phosphate phosphoribosyltransferase
  • MTBC0 PGAP product: decaprenyl-phosphate phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): UbiA PF01040.24 (E=2e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218323.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UbiA (PF01040.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0382
  • Curated reference: UniProt P9WFR5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 79 functional partner(s); context anchor Rv3807c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004034|Rv3806c|ubiA
MSEDVVTQPPANLVAGVVKAIRPRQWVKNVLVLAAPLAALGGGVRYDYVEVLSKVSMAFVVFSLAASAVYLVNDVRDVEADREHPTKRFRPIAAGVVPEWLAYTVAVVLGVTSLAGAWMLTPNLALVMVVYLAMQLAYCFGLKHQAVVDICVVSSAYLIRAIAGGVATKIPLSKWFLLIMAFGSLFMVAGKRYAELHLAERTGAAIRKSLESYTSTYLRFVWTLSATAVVLCYGLWAFERDGYSGSWFAVSMIPFTIAILRYAVDVDGGLAGEPEDIALRDRVLQLLALAWIATVGAAVAFG