rskA Resolved · high auto-curated

H37Rv Rv0444c · MTBC0 mtbc0_000466 · 232 aa · 536456–537154 (-) · RefSeq NP_214958.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-sigma-K factor RskA
MTBC0 PGAP re-annotationanti-sigma-K factor RskA
Revised (this work)Anti-sigma-K factor RskA. Pfam: RskA_N (PF22618.2), RskA_C (PF10099.15).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGX5 SwissProt · reviewed · Evidence at protein level
UniProt nameAnti-sigma-K factor RskA
Curated functionAn anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigK. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating th.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namerskA
eggNOG descriptionAn anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigK. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating the sigma factor
Orthologous groupCOG5343
Gene Ontology (36) GO:0000988, GO:0000989, GO:0003674, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006417, GO:0008150, GO:0009889, GO:0010468, GO:0010556 +24 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.026 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RskA_NPF22618.2 4.5e-239–56 Anti-sigma-K factor RskA, N-terminal domain
RskA_CPF10099.15 3.1e-2594–225 Anti-sigma-K factor rskA, C-terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigK (ECF RNA polymerase sigma factor SigK), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0445c sigK ECF RNA polymerase sigma factor SigK 999 999 ctx neighborhood:706 cooccurence:636 experimental:987 textmining:906
Rv0448c hyp hypothetical protein 674 673 ctx neighborhood:611
Rv0446c transmembrane protein 673 673 ctx neighborhood:593
Rv2164c hyp hypothetical protein 633 633 ctx cooccurence:628
Rv0538 membrane protein 621 622 ctx cooccurence:618
Rv0447c ufaA1 cyclopropane-fatty-acyl-phospholipid synthase UfaA 619 617 ctx neighborhood:611
Rv0339c iniR transcriptional regulator 608 608 ctx cooccurence:601
Rv3903c cpnT hyp hypothetical protein 599 600 ctx cooccurence:594
Rv2113 integral membrane protein 592 592 ctx cooccurence:587
Rv3909 hyp hypothetical protein 563 563 ctx cooccurence:557
Rv3835 hyp hypothetical protein 537 538 ctx cooccurence:533
Rv1853 ureD urease accessory protein UreD 523 524 ctx cooccurence:518
Rv0449c hyp hypothetical protein 774 522 ctx neighborhood:517 textmining:547
Rv1024 membrane protein 481 481 ctx cooccurence:468
Rv2843 hyp hypothetical protein 473 473 ctx cooccurence:466

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anti-sigma-K factor RskA
  • MTBC0 PGAP product: anti-sigma-K factor RskA
  • Pfam (hmmscan --cut_ga): RskA_N PF22618.2 (E=4e-23), RskA_C PF10099.15 (E=3e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214958.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RskA_N (PF22618.2), RskA_C (PF10099.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5343
  • Curated reference: UniProt P9WGX5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor sigK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000466|Rv0444c|rskA
MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIAVGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNVAPPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPTGTILAELPLG