adnA Resolved · high auto-curated

H37Rv Rv3202c · MTBC0 mtbc0_003406 · 1055 aa · 3599175–3602342 (-) · RefSeq NP_217718.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP-dependent DNA helicase
MTBC0 PGAP re-annotationATP-dependent DNA helicase AdnA
Revised (this work)ATP-dependent DNA helicase AdnA. Pfam: UvrD-helicase (PF00580.28), AAA_19 (PF13245.13), UvrD_C (PF13361.13), PDDEXK_1 (PF12705.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53348 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDNA 3'-5' helicase
EC (curated) EC 5.6.2.4

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred nameuvrD3
eggNOG descriptionBelongs to the helicase family. UvrD subfamily
Orthologous groupCOG0210

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.5 · purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UvrD-helicasePF00580.28 2.0e-479–302 UvrD/REP helicase N-terminal domain
AAA_19PF13245.13 1.3e-0919–291 AAA domain
UvrD_CPF13361.13 2.0e-09559–694 UvrD-like helicase C-terminal domain
PDDEXK_1PF12705.14 1.4e-45805–1047 PD-(D/E)XK nuclease superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: adnB (ATP-dependent DNA helicase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3201c adnB ATP-dependent DNA helicase 999 1000 ctx neighborhood:881 experimental:997 database:540
Rv3198c uvrD2 ATP-dependent DNA helicase UvrD 890 891 ctx cooccurence:563 database:540
Rv2191 hyp hypothetical protein 885 841 coexpression:810
Rv3199c nudC NADH pyrophosphatase 828 828 ctx neighborhood:747
Rv3585 radA DNA repair protein RadA 836 821 coexpression:811
Rv3200c transmembrane cation transporter 813 806 ctx neighborhood:801
Rv2737c recA recombinase A 869 799 coexpression:402 experimental:632
Rv0949 uvrD1 ATP-dependent DNA helicase UvrD 763 764 database:540
Rv3586 disA DNA integrity scanning protein DisA 751 751 coexpression:751
Rv0058 dnaB replicative DNA helicase 841 746 coexpression:415 textmining:403
Rv3555c hyp hypothetical protein 744 745 coexpression:730
Rv0048c membrane protein 738 738 ctx cooccurence:718
Rv3662c hyp hypothetical protein 723 724 ctx cooccurence:702
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 720 720 ctx neighborhood:544
Rv1171 hyp hypothetical protein 708 709 ctx cooccurence:708

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP-dependent DNA helicase
  • MTBC0 PGAP product: ATP-dependent DNA helicase AdnA
  • Pfam (hmmscan --cut_ga): UvrD-helicase PF00580.28 (E=2e-47), AAA_19 PF13245.13 (E=1e-09), UvrD_C PF13361.13 (E=2e-09), PDDEXK_1 PF12705.14 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217718.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UvrD-helicase (PF00580.28), AAA_19 (PF13245.13), UvrD_C (PF13361.13), PDDEXK_1 (PF12705.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0210
  • Curated reference: UniProt O53348 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 96 functional partner(s); context anchor adnB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003406|Rv3202c|adnA
MSHIWGVEAGAALAPGLRGPVLVLGGPGTGKSTLLVEAAVAHIGAGTDPESVLLLTGSGRMGMRARSALTTALLRSRTNGPCRAAIREPVVRTVHSYAYAVLRKAAQRAGDALPRLLTSAEQDAIIRELLAGDAEDGPAATTTWPAHLRPALTTAGFATELRNLLARCAERGLDPLELQQLGRRRGRPEWIAAGQFAQRYEQVMLLRGAVGLAAPQATAPALSAAELVGAALEAFAVDPELLAAERARVRTLLVDDAQQLDPQAARLVRMLAAGTELALIAGDPNQAVFGFRGGEPTGLLADDPPPAGGAPIPSVTLTVSHRCAPAVARAVTGIARRLPGRSVGRRIEGTGTEVGSVTVRLAGSAHAEAAMIADALRRAHLIDGVPWSQMAVIVRSVPRAVRLPRALAAAGVPVAPPAVGGPLSAEPAVRALLTVLEATADGLDGDQALLLLTGPIGGVDPVSLRQLRRTLQRARPGQTSRKFGDLLVEVLGGDAPPSGPGSRALRRVRAVLTAAARCHRSGSLGGQDPRHTLWAAWQRSGLQRRWLAASEHGGAAAVQATRDLETVTALFDITDHYVSRTSGASLRGLVEHVTALQLPVVRPEPAAPTEQVMVLSAHAALGHEWDLVVIAGLQDGLWPNTVPRGGVLGTQRLLDELDGVTKDASMRAPLLAEERRLLVTAMGRARRRLLVTAVDSDAGGGGHEAVLPSAFFFEIAQWADGDGEPVAMQPVSAPRVLSAAAVVGRLRAVVCAPACAVDDADRDCAATQLARLAKAGVPGADPSEWHGLAPVSTSDPLCDSDDLVTLTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHALFAEPGRSESQLLAELDRVWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARKIRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAEGLVRAGDEPGGARLVYVGKSGAAGVAERKQDPLTPAARDEWRNLVRQLAAATAGPQFIARRNDGCTHCPLRPGCPAHVRGSAP