adnA Resolved · high auto-curated
H37Rv Rv3202c · MTBC0 mtbc0_003406 ·
1055 aa ·
3599175–3602342 MTBC0
(-) ·
RefSeq NP_217718.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ATP-dependent DNA helicase |
|---|---|
| MTBC0 PGAP re-annotation | ATP-dependent DNA helicase AdnA |
| Revised (this work) | ATP-dependent DNA helicase AdnA. Pfam: UvrD-helicase (PF00580.28), AAA_19 (PF13245.13), UvrD_C (PF13361.13), PDDEXK_1 (PF12705.14). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 61 publications
61 TB publications mention this gene. 61 publication(s) discuss this gene (43 in a M. tuberculosis context, 14 in other mycobacteria — M. leprae (12)).
| Publication | Date |
|---|---|
| dUTPase modulates mycobacterial homologous recombination and interacts with the AdnAB helicase-nuclease. doi:10.1093/nar/gkag660 | 2026 |
| Structure of an initiation complex of mycobacterial helicase-nuclease AdnAB at a blunt double-strand break reveals local melting that engages the 3' tracking strand at the ratchet pawl of the helicase motor. doi:10.1093/nar/gkag243 | 2026 |
| Insights into the pathogenesis and differential diagnosis of clival lesions in an individual from a 16th-century-CE mass grave at Mohács (Southwestern Hungary). doi:10.1371/journal.pone.0340762 | 2026 |
| First confirmation of Mycobacterium tuberculosis complex from medieval Ireland by aDNA analysis - palaeopathological and microbial findings. doi:10.1016/j.tube.2025.102710 | 2026 |
| A possible case of hypertrophic osteopathy in osteological remains representing cattle hide processing from a Roman villa in England. doi:10.1016/j.ijpp.2025.11.003 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | uvrD2 (Rv3201c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4 (whiB4).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.50 (95% CI -1.75 to 3.71). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Has both ATPase and helicase activities |
|---|---|
| Mycobrowser EC |
3.6.1.-
· differs from the atlas (5.6.2.4) — ATP-dependent DNA helicase: EC 3.6.1.-/3.6.4.12 moved to 5.6.2.4 (motor activity) in 2018
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3227c
· 99.9% identity |
|---|---|
| M. marinum |
MMAR_1358
· 76.5% identity |
| M. smegmatis |
MSMEG_1941
· 62.3% identity |
| M. orygis |
RJtmp_003299
· 99.7% identity |
| M. abscessus |
MAB_3516c
· 50.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53348
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DNA 3'-5' helicase |
| EC (curated) |
EC 5.6.2.4
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | uvrD3 |
| eggNOG description | Belongs to the helicase family. UvrD subfamily |
| Orthologous group | COG0210 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.5 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 74.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 40.3% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 30 in the ORF — 0 in the essential state, 0 growth-defect, 30 non-essential, 0 growth-advantage. Saturation 0.933, mean read count 103.571428571. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +2.38 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +1.54 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=631) from East Asian lineage (compared to H37Rv control) (strain background) | +1.46 | 0.005 | required |
| Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +1.31 | 0.0054 | required |
| fitness in mouse infection (in vivo) | +1.05 | 0.0052 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.04 | 0.046 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.38 ppm · rank 3386/3519 (3.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 1055 aa |
|---|---|
| Molecular weight | 110.7 kDa |
| Theoretical pI | 8.72 |
| GRAVY | -0.039 (hydrophilic) |
| Aliphatic index | 96.1 |
| Aromaticity | 0.035 |
| Instability index | 44.1 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
UvrD-helicase | PF00580.28 | 2.0e-47 | 9–302 | UvrD/REP helicase N-terminal domain |
AAA_19 | PF13245.13 | 1.3e-09 | 19–291 | AAA domain |
UvrD_C | PF13361.13 | 2.0e-09 | 559–694 | UvrD-like helicase C-terminal domain |
PDDEXK_1 | PF12705.14 | 1.4e-45 | 805–1047 | PD-(D/E)XK nuclease superfamily |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7sjr-assembly1_A |
1.00 | 0.92 | 1.1e-83 sig | 7sjr-assembly1_A Cryo-EM structure of AdnA-AdnB(W325A) in complex with DNA and AMPPNP |
6ppj-assembly1_A |
1.00 | 0.92 | 4.7e-82 sig | 6ppj-assembly1_A Cryo-EM structure of AdnA(D934A)-AdnB(D1014A) in complex with AMPPNP |
6ppr-assembly1_A |
1.00 | 0.91 | 8.0e-75 sig | 6ppr-assembly1_A Cryo-EM structure of AdnA(D934A)-AdnB(D1014A) in complex with AMPPNP and DNA |
6ppu-assembly1_A |
1.00 | 0.86 | 1.3e-48 sig | 6ppu-assembly1_A Cryo-EM structure of AdnAB-AMPPNP-DNA complex |
2is6-assembly1_A |
1.00 | 0.66 | 3.5e-30 sig | 2is6-assembly1_A Crystal structure of UvrD-DNA-ADPMgF3 ternary complex |
Foldseek search of the AlphaFold DB model (mean pLDDT 85.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv3201c (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3202a (+ strand, 85 bp gap) |
| Predicted operon |
Rv3201c · Rv3202c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: adnB (ATP-dependent DNA helicase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3201c adnB exp |
ATP-dependent DNA helicase | 999 | 1000 ctx | neighborhood:881 experimental:997 database:540 |
Rv3198c uvrD2 exp |
ATP-dependent DNA helicase UvrD | 890 | 891 ctx | cooccurence:563 database:540 |
Rv2191 hyp |
hypothetical protein | 885 | 841 | coexpression:810 |
Rv3199c nudC |
NADH pyrophosphatase | 828 | 828 ctx | neighborhood:747 |
Rv3585 radA |
DNA repair protein RadA | 836 | 821 | coexpression:811 |
Rv3200c |
transmembrane cation transporter | 813 | 806 ctx | neighborhood:801 |
Rv2737c recA exp |
recombinase A | 869 | 799 | coexpression:402 experimental:632 |
Rv0949 uvrD1 exp |
ATP-dependent DNA helicase UvrD | 763 | 764 | database:540 |
Rv3586 disA |
DNA integrity scanning protein DisA | 751 | 751 | coexpression:751 |
Rv0058 dnaB |
replicative DNA helicase | 841 | 746 | coexpression:415 textmining:403 |
Rv3555c hyp |
hypothetical protein | 744 | 745 | coexpression:730 |
Rv0048c |
membrane protein | 738 | 738 ctx | cooccurence:718 |
Rv3662c hyp |
hypothetical protein | 723 | 724 ctx | cooccurence:702 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 720 | 720 ctx | neighborhood:544 |
Rv1171 hyp |
hypothetical protein | 708 | 709 ctx | cooccurence:708 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ATP-dependent DNA helicase
- MTBC0 PGAP product: ATP-dependent DNA helicase AdnA
- Pfam (hmmscan --cut_ga): UvrD-helicase PF00580.28 (E=2e-47), AAA_19 PF13245.13 (E=1e-09), UvrD_C PF13361.13 (E=2e-09), PDDEXK_1 PF12705.14 (E=1e-45)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217718.1)
- Domains: Pfam-A via hmmscan --cut_ga — UvrD-helicase (PF00580.28), AAA_19 (PF13245.13), UvrD_C (PF13361.13), PDDEXK_1 (PF12705.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0210 - Curated reference: UniProt O53348 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
96 functional partner(s); context anchor
adnB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003406|Rv3202c|adnA MSHIWGVEAGAALAPGLRGPVLVLGGPGTGKSTLLVEAAVAHIGAGTDPESVLLLTGSGRMGMRARSALTTALLRSRTNGPCRAAIREPVVRTVHSYAYAVLRKAAQRAGDALPRLLTSAEQDAIIRELLAGDAEDGPAATTTWPAHLRPALTTAGFATELRNLLARCAERGLDPLELQQLGRRRGRPEWIAAGQFAQRYEQVMLLRGAVGLAAPQATAPALSAAELVGAALEAFAVDPELLAAERARVRTLLVDDAQQLDPQAARLVRMLAAGTELALIAGDPNQAVFGFRGGEPTGLLADDPPPAGGAPIPSVTLTVSHRCAPAVARAVTGIARRLPGRSVGRRIEGTGTEVGSVTVRLAGSAHAEAAMIADALRRAHLIDGVPWSQMAVIVRSVPRAVRLPRALAAAGVPVAPPAVGGPLSAEPAVRALLTVLEATADGLDGDQALLLLTGPIGGVDPVSLRQLRRTLQRARPGQTSRKFGDLLVEVLGGDAPPSGPGSRALRRVRAVLTAAARCHRSGSLGGQDPRHTLWAAWQRSGLQRRWLAASEHGGAAAVQATRDLETVTALFDITDHYVSRTSGASLRGLVEHVTALQLPVVRPEPAAPTEQVMVLSAHAALGHEWDLVVIAGLQDGLWPNTVPRGGVLGTQRLLDELDGVTKDASMRAPLLAEERRLLVTAMGRARRRLLVTAVDSDAGGGGHEAVLPSAFFFEIAQWADGDGEPVAMQPVSAPRVLSAAAVVGRLRAVVCAPACAVDDADRDCAATQLARLAKAGVPGADPSEWHGLAPVSTSDPLCDSDDLVTLTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHALFAEPGRSESQLLAELDRVWGHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSELTEVGVEVDIDGALEDGSGQARKIRLRGRADRLERDPAGRLVIVDIKTGKTPVSKDDAQQHAQLAMYQLAVAEGLVRAGDEPGGARLVYVGKSGAAGVAERKQDPLTPAARDEWRNLVRQLAAATAGPQFIARRNDGCTHCPLRPGCPAHVRGSAP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for adnA? Email the maintainer — the message is pre-filled with this gene's details.