Rv0181c Family assigned · medium

H37Rv Rv0181c · MTBC0 mtbc0_000194 · 244 aa · 212625–213359 (-) · RefSeq NP_214695.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationpirin family protein
Revised (this work)Pirin-family cupin metalloenzyme (Pfam Pirin PF02678 + Pirin_C_2 PF17954). A bicupin, often Fe-dependent (quercetinase / related dioxygenase chemistry); specific substrate not established.

Curated reference (UniProt)

UniProt P9WI85 SwissProt · reviewed · Evidence at protein level
UniProt namePutative quercetin 2,3-dioxygenase Rv0181c
EC (curated) EC 1.13.11.24
Curated functionPutative quercetin 2,3-dioxygenase.

UniProt still lists this protein as Putative quercetin 2,3-dioxygenase Rv0181c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBelongs to the pirin family
Orthologous groupCOG1741
KEGG orthology K06911
Gene Ontology (11) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0044424, GO:0044444, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PirinPF02678.23 8.2e-3812–122 Pirin
Pirin_C_2PF17954.8 1.7e-06156–235 Quercetinase C-terminal cupin domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0180c (transmembrane protein), high confidence from genomic context alone (score 848 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0180c transmembrane protein 968 848 ctx neighborhood:846 textmining:803
Rv0182c sigG ECF RNA polymerase sigma factor SigG 836 767 ctx neighborhood:745
Rv0179c lprO lipoprotein LprO 782 564 ctx neighborhood:563 textmining:520
Rv0183 lysophospholipase 840 557 ctx neighborhood:557 textmining:653
Rv0185 hyp hypothetical protein 474 474 ctx neighborhood:459
Rv0184 hyp hypothetical protein 474 474 ctx neighborhood:461
Rv1364c sigma factor regulatory protein 420 419 coexpression:418
Rv0186 bglS beta-glucosidase BglS 400 401
Rv0654 carotenoid cleavage oxygenase 583 183 textmining:511
Rv0887c hyp hypothetical protein 838 165 textmining:814
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 548 68 textmining:535
Rv2010 vapC15 ribonuclease VapC15 587 55 textmining:581
Rv0911 hyp hypothetical protein 806 52 textmining:804
Rv0234c gabD1 succinate-semialdehyde dehydrogenase 678 47 textmining:676
Rv2009 vapB15 antitoxin VapB15 654 47 textmining:652

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'pirin family protein'
  • Pfam: Pirin PF02678 (E=8.2e-38), Pirin_C_2 PF17954 (E=1.7e-06)

ESM Atlas signal (exploratory)

Ancestral protein hash bb58cd8e96c547f3f1789973b1de72f9 · 10 ESM-space neighbours (max similarity 0.919). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
114466 0.94 Cupin/DSBH metal-binding scaffold
214257 0.91 Cupin/DSBH N-terminal entry cap
312580 0.88 Acidic His/Gly binding loop
4869 0.87 Glycine/acidic ligand-sensing loops
53059 0.85 Histidine-acidic metal-binding motif
612737 0.82 Conserved ligand-facing beta hairpin
75835 0.77 Conserved functional core segments
815646 0.74 Cupin/CNBD ligand-binding loop

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214695.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pirin (PF02678.23), Pirin_C_2 (PF17954.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1741
  • Curated reference: UniProt P9WI85 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv0180c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000194|Rv0181c|
MTATVEIRRAADRAVTTTSWLKSRHSFSFGDHYDPDNTHHGLLLVNNDDQMEPASGFDPHPHRDMEIVTWVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILHSEMNDSATEPVHFVQMWVIPDATGITASYQQQEIDDELLRAGLVTIASGIPGQDAALTLHNSSASLHGARLRPGATVSLPCAPFLHLFVAYGRLTLEGGGELADGDAVRFTDADARGLTANEPSEVLIWEMHAKLGDSAT