ilvD Resolved · high auto-curated
H37Rv Rv0189c · MTBC0 mtbc0_000203 ·
575 aa ·
220344–222071 MTBC0
(-) ·
RefSeq NP_214703.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dihydroxy-acid dehydratase |
|---|---|
| MTBC0 PGAP re-annotation | dihydroxy-acid dehydratase |
| Revised (this work) | Dihydroxy-acid dehydratase. Pfam: ILVD_EDD_N (PF00920.28), ILV_EDD_C (PF24877.2). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Comparative genomics and epidemic success of Mycobacterium tuberculosis lineage 4 in eastern China. doi:10.1186/s12864-026-13035-9 | 2026 |
| Downregulation of Rv0189c, encoding a dihydroxyacid dehydratase, affects growth of Mycobacterium tuberculosis in vitro and in mice. doi:10.1099/mic.0.042358-0 | 2011 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Post-translational modifications
2 reported modified residue(s):
N-acetylproline @2, N6-carboxylysine @139.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -7.99 (95% CI -8.80 to -7.17). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in valine and isoleucine biosynthesis (at the fourth step) [catalytic activity: 2,3-dihydroxy-3-methylbutanoate = 3-methyl-2- oxobutanoate + H(2)O]. |
|---|---|
| Mycobrowser EC |
4.2.1.9
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0195c
· 100.0% identity |
|---|---|
| M. leprae |
ML2608c
· 90.0% identity |
| M. marinum |
MMAR_0432
· 91.6% identity |
| M. smegmatis |
MSMEG_0229
· 85.2% identity |
| M. orygis |
RJtmp_000204
· 99.8% identity |
| M. abscessus |
MAB_4545
· 85.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKJ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Dihydroxy-acid dehydratase |
| EC (curated) |
EC 4.2.1.9
|
| Curated function | Functions in the biosynthesis of branched-chain amino acids. Catalyzes the dehydration of (2R,3R)-2,3-dihydroxy-3-methylpentanoate (2,3-dihydroxy-3-methylvalerate) into 2-oxo-3-methylpentanoate (2-oxo-3-methylvalerate) and of (2R)-2,3-dihydroxy-3-methylbutanoate (2,3-dihydroxyisovalerate) into 2-oxo-3-methylbutanoate (2-oxoisovalerate), the penultimate precursor to L-isoleucine and L-valine, respectively. Is specific for the (R) isomer of 2,3-dihydroxy-3-methylbutanoate, with no catalytic activity against the (S) isomer. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | ilvD |
| eggNOG description | Belongs to the ILVD EDD family |
| Orthologous group | COG0129 |
| EC number |
EC 4.2.1.9
|
| KEGG orthology |
K01687
|
| KEGG pathways |
map00290, map00770, map01100, map01110, map01130, map01210, map01230
|
| KEGG modules |
M00019, M00570
|
| Gene Ontology (36) |
GO:0003674, GO:0003824, GO:0004160, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006807, GO:0008150, GO:0008152, GO:0008652 +24 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.713 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.102
· 9 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.102) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 91.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 58.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 23 in the ORF — 23 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +5.77 | 0.044 | required |
| Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +5.46 | 0.0054 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +4.61 | 0.0075 | required |
Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 503.0 ppm · rank 402/3519 (88.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 575 aa |
|---|---|
| Molecular weight | 59.4 kDa |
| Theoretical pI | 5.06 |
| GRAVY | 0.155 (hydrophobic) |
| Aliphatic index | 94.9 |
| Aromaticity | 0.042 |
| Instability index | 34.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ILVD_EDD_N | PF00920.28 | 4.1e-132 | 49–371 | Dihydroxy-acid/6-phosphogluconate dehydratase N-terminal |
ILV_EDD_C | PF24877.2 | 1.3e-68 | 383–572 | Dihydroxy-acid/6-phosphogluconate dehydratase C-terminal |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
6ovt |
X-ray diffraction | 1.88 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6ovt-assembly1_A |
1.00 | 0.99 | 4.6e-102 sig | 6ovt-assembly1_A Crystal Structure of IlvD from Mycobacterium tuberculosis |
6ovt-assembly1_D |
1.00 | 0.98 | 1.1e-98 sig | 6ovt-assembly1_D Crystal Structure of IlvD from Mycobacterium tuberculosis |
6ovt-assembly1_B |
1.00 | 0.98 | 7.8e-98 sig | 6ovt-assembly1_B Crystal Structure of IlvD from Mycobacterium tuberculosis |
6ovt-assembly1_C |
1.00 | 0.98 | 8.3e-98 sig | 6ovt-assembly1_C Crystal Structure of IlvD from Mycobacterium tuberculosis |
5ze4-assembly1_A |
1.00 | 0.95 | 1.2e-66 sig | 5ze4-assembly1_A The structure of holo- structure of DHAD complex with [2Fe-2S] cluster |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv0188 (+ strand, 78 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0190 (+ strand, 147 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: ilvC (ketol-acid reductoisomerase), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3001c ilvC exp |
ketol-acid reductoisomerase | 998 | 995 ctx | cooccurence:733 coexpression:791 database:900 textmining:802 |
Rv2210c ilvE exp |
branched-chain amino acid aminotransferase | 994 | 982 | coexpression:669 database:900 textmining:736 |
Rv3710 leuA exp |
2-isopropylmalate synthase | 988 | 965 | coexpression:655 database:900 textmining:695 |
Rv3003c ilvB1 |
acetolactate synthase large subunit IlvB | 967 | 955 ctx | fusion:615 cooccurence:753 coexpression:506 |
Rv2988c leuC |
3-isopropylmalate dehydratase large subunit | 967 | 933 ctx | cooccurence:546 coexpression:846 textmining:540 |
Rv0337c aspC exp |
aspartate aminotransferase | 927 | 921 | database:900 |
Rv2225 panB exp |
3-methyl-2-oxobutanoate hydroxymethyltransferase | 929 | 901 | database:900 |
Rv2987c leuD |
3-isopropylmalate dehydratase small subunit | 936 | 893 ctx | cooccurence:606 coexpression:718 textmining:427 |
Rv2995c leuB |
3-isopropylmalate dehydrogenase | 967 | 892 ctx | cooccurence:435 coexpression:791 textmining:713 |
Rv3002c ilvN |
acetolactate synthase small subunit | 960 | 892 ctx | cooccurence:583 coexpression:650 textmining:655 |
Rv3470c ilvB2 |
acetolactate synthase large subunit | 869 | 856 ctx | cooccurence:715 coexpression:499 |
Rv1559 ilvA |
threonine dehydratase IlvA | 946 | 845 ctx | cooccurence:405 coexpression:729 textmining:667 |
Rv3859c gltB |
glutamate synthase large subunit | 933 | 798 | coexpression:771 textmining:682 |
Rv0812 |
4-amino-4-deoxychorismate lyase | 815 | 791 | coexpression:668 |
Rv0190 ricR hyp |
hypothetical protein | 773 | 773 ctx | neighborhood:772 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dihydroxy-acid dehydratase
- MTBC0 PGAP product: dihydroxy-acid dehydratase
- Pfam (hmmscan --cut_ga): ILVD_EDD_N PF00920.28 (E=4e-132), ILV_EDD_C PF24877.2 (E=1e-68)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214703.1)
- Domains: Pfam-A via hmmscan --cut_ga — ILVD_EDD_N (PF00920.28), ILV_EDD_C (PF24877.2)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0129 - Curated reference: UniProt P9WKJ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
88 functional partner(s); context anchor
ilvC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000203|Rv0189c|ilvD MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDEDFAKPQIGVASSWNEITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEGMHFSLVSREVIADSVEVVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAKLSDGSERDVTIIDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANTMASAAEALGMSLPGSAAPPATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAIAHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHIGGVPVVMKALLDAGLLHGDCLTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGITILHGSLAPEGAVVKTAGFDSDVFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRNGDRIRLDVAGRVLDVLADPAEFASRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ilvD? Email the maintainer — the message is pre-filled with this gene's details.