Rv0048c Family assigned · low

H37Rv Rv0048c · MTBC0 mtbc0_000053 · 289 aa · 51927–52796 (-) · RefSeq NP_214562.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF1707 domain-containing protein
Revised (this work)Lipoprotein of the EnvF-like family (cell-envelope). RefSeq leaves it 'membrane protein'.

Curated reference (UniProt)

UniProt P9WM87 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0048c

UniProt still lists this protein as Uncharacterized protein Rv0048c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF1707)
Orthologous group2FB62
Gene Ontology (14) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0030312, GO:0031224, GO:0031226, GO:0044425, GO:0044459 +2 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.135 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1707PF08044.17 2.4e-1617–69 DUF1707 SHOCT-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3779 (transmembrane protein), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3779 transmembrane protein 773 773 ctx cooccurence:767
Rv1171 hyp hypothetical protein 767 767 ctx cooccurence:767
Rv0875c hyp hypothetical protein 756 756 ctx cooccurence:756
Rv2423 hyp hypothetical protein 752 753 ctx cooccurence:751
Rv0188 transmembrane protein 746 747 ctx cooccurence:746
Rv3773c hyp hypothetical protein 744 744 ctx cooccurence:744
Rv2079 hyp hypothetical protein 739 739 ctx cooccurence:739
Rv3202c adnA ATP-dependent DNA helicase 738 738 ctx cooccurence:718
Rv0517 acyltransferase 737 738 ctx cooccurence:734
Rv3899c hyp hypothetical protein 727 718 ctx cooccurence:706
Rv1075c hyp hypothetical protein 715 716 ctx cooccurence:649
Rv3435c transmembrane protein 715 715 ctx cooccurence:714
Rv1635c mannosyltransferase 713 713 ctx cooccurence:713
Rv3481c integral membrane protein 707 708 ctx cooccurence:707
Rv2525c hyp hypothetical protein 704 703 ctx cooccurence:697

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: lipoprotein EnvF, TM 0.50, E 3e-6
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214562.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1707 (PF08044.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2FB62
  • Curated reference: UniProt P9WM87 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 80 functional partner(s); context anchor Rv3779
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000053|Rv0048c|
MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEHRERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGVGIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTMGYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTAVGIMRGAPETLGLKQSDVKSMYLIVEPAKDPTTPAALSLSLYVSSDYGGGYLVFAGDGTIKHVSYPS