Rv0187 Resolved · high auto-curated
H37Rv Rv0187 · MTBC0 mtbc0_000201 ·
220 aa · 219053–219715 (+) ·
RefSeq NP_214701.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | O-methyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | O-methyltransferase |
| Revised (this work) | O-methyltransferase. Pfam: Methyltransf_3 (PF01596.24), PCMT (PF01135.26), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_24 (PF13578.13), Methyltransf_11 (PF08241.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O07431
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Catechol O-methyltransferase |
| EC (curated) |
EC 2.1.1.6
|
| Curated function | Catechol O-methyltransferase that can use various catechol-like compounds such as gallic acid (GA), 3,4-dihydroxy-5-methoxy-benzoic acid (5OMeBA), protocatechuic acid (PCA), 3,4-dihydroxy-benzaldehyde (DHA), dopamine, caffeic acid (CA), luteolin, quercetin, and 5-hydroxyuridine. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | O-methyltransferase |
| Orthologous group | COG4122 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.534 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 1.31% of strains (1907) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Methyltransf_3 | PF01596.24 | 4.8e-34 | 36–187 | O-methyltransferase |
PCMT | PF01135.26 | 1.4e-07 | 55–141 | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) |
Methyltransf_31 | PF13847.13 | 5.3e-09 | 63–167 | Methyltransferase domain |
Methyltransf_25 | PF13649.13 | 4.0e-07 | 64–138 | Methyltransferase domain |
Methyltransf_24 | PF13578.13 | 1.9e-18 | 65–167 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 5.0e-05 | 65–138 | Methyltransferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mymT (metallothionein), medium confidence from genomic context alone (score 649 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0186A mymT |
metallothionein | 648 | 649 ctx | neighborhood:649 |
Rv1445c devB |
6-phosphogluconolactonase | 637 | 638 ctx | fusion:625 |
Rv0184 hyp |
hypothetical protein | 546 | 547 ctx | neighborhood:544 |
Rv0188 |
transmembrane protein | 543 | 544 ctx | neighborhood:541 |
Rv1710 scpB |
segregation and condensation protein ScpB | 444 | 444 | |
Rv2372c rsmE |
rRNA small subunit methyltransferase E | 409 | 410 | coexpression:410 |
Rv2928 tesA |
thioesterase TesA | 403 | 404 ctx | cooccurence:400 |
Rv1905c aao |
D-amino acid oxidase | 632 | 192 | textmining:564 |
Rv2303c |
antibiotic-resistance protein | 656 | 111 | textmining:630 |
Rv3034c |
acetyltransferase | 665 | 106 | textmining:641 |
Rv3030 |
S-adenosylmethionine-dependent methyltransferase | 648 | 103 | textmining:624 |
Rv1147 hyp |
hypothetical protein | 710 | 100 | textmining:691 |
Rv3032 |
glycogen synthase | 408 | 98 | |
Rv1694 tlyA |
16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA | 686 | 77 | textmining:674 |
Rv1862 adhA |
alcohol dehydrogenase A | 677 | 77 | textmining:665 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: O-methyltransferase
- MTBC0 PGAP product: O-methyltransferase
- Pfam (hmmscan --cut_ga): Methyltransf_3 PF01596.24 (E=5e-34), PCMT PF01135.26 (E=1e-07), Methyltransf_31 PF13847.13 (E=5e-09), Methyltransf_25 PF13649.13 (E=4e-07), Methyltransf_24 PF13578.13 (E=2e-18), Methyltransf_11 PF08241.19 (E=5e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214701.1)
- Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_3 (PF01596.24), PCMT (PF01135.26), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_24 (PF13578.13), Methyltransf_11 (PF08241.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4122 - Curated reference: UniProt O07431 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
mymT - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000201|Rv0187| MGMDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR