Rv0187 Resolved · high auto-curated

H37Rv Rv0187 · MTBC0 mtbc0_000201 · 220 aa · 219053–219715 (+) · RefSeq NP_214701.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)O-methyltransferase
MTBC0 PGAP re-annotationO-methyltransferase
Revised (this work)O-methyltransferase. Pfam: Methyltransf_3 (PF01596.24), PCMT (PF01135.26), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_24 (PF13578.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07431 SwissProt · reviewed · Evidence at protein level
UniProt nameCatechol O-methyltransferase
EC (curated) EC 2.1.1.6
Curated functionCatechol O-methyltransferase that can use various catechol-like compounds such as gallic acid (GA), 3,4-dihydroxy-5-methoxy-benzoic acid (5OMeBA), protocatechuic acid (PCA), 3,4-dihydroxy-benzaldehyde (DHA), dopamine, caffeic acid (CA), luteolin, quercetin, and 5-hydroxyuridine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionO-methyltransferase
Orthologous groupCOG4122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.534 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 1.31% of strains (1907) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_3PF01596.24 4.8e-3436–187 O-methyltransferase
PCMTPF01135.26 1.4e-0755–141 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Methyltransf_31PF13847.13 5.3e-0963–167 Methyltransferase domain
Methyltransf_25PF13649.13 4.0e-0764–138 Methyltransferase domain
Methyltransf_24PF13578.13 1.9e-1865–167 Methyltransferase domain
Methyltransf_11PF08241.19 5.0e-0565–138 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mymT (metallothionein), medium confidence from genomic context alone (score 649 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0186A mymT metallothionein 648 649 ctx neighborhood:649
Rv1445c devB 6-phosphogluconolactonase 637 638 ctx fusion:625
Rv0184 hyp hypothetical protein 546 547 ctx neighborhood:544
Rv0188 transmembrane protein 543 544 ctx neighborhood:541
Rv1710 scpB segregation and condensation protein ScpB 444 444
Rv2372c rsmE rRNA small subunit methyltransferase E 409 410 coexpression:410
Rv2928 tesA thioesterase TesA 403 404 ctx cooccurence:400
Rv1905c aao D-amino acid oxidase 632 192 textmining:564
Rv2303c antibiotic-resistance protein 656 111 textmining:630
Rv3034c acetyltransferase 665 106 textmining:641
Rv3030 S-adenosylmethionine-dependent methyltransferase 648 103 textmining:624
Rv1147 hyp hypothetical protein 710 100 textmining:691
Rv3032 glycogen synthase 408 98
Rv1694 tlyA 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA 686 77 textmining:674
Rv1862 adhA alcohol dehydrogenase A 677 77 textmining:665

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: O-methyltransferase
  • MTBC0 PGAP product: O-methyltransferase
  • Pfam (hmmscan --cut_ga): Methyltransf_3 PF01596.24 (E=5e-34), PCMT PF01135.26 (E=1e-07), Methyltransf_31 PF13847.13 (E=5e-09), Methyltransf_25 PF13649.13 (E=4e-07), Methyltransf_24 PF13578.13 (E=2e-18), Methyltransf_11 PF08241.19 (E=5e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214701.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_3 (PF01596.24), PCMT (PF01135.26), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_24 (PF13578.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4122
  • Curated reference: UniProt O07431 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor mymT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000201|Rv0187|
MGMDQQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR