Rv1171 Family assigned · low

H37Rv Rv1171 · MTBC0 mtbc0_001260 · 146 aa · 1309748–1310188 (+) · RefSeq NP_215687.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Polytopic integral membrane protein with 4 predicted transmembrane helices (DeepTMHMM). RefSeq leaves it 'hypothetical protein'. A topological feature consistent with a membrane transporter/permease or membrane-embedded enzyme; the transported substrate and molecular function are undetermined.

Curated reference (UniProt)

UniProt O50427 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AY9H

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.618 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 90.2 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3n1e-assembly2_B 0.28 0.40 2.1e+00 3n1e-assembly2_B Vps54 C-terminal domain
3axj-assembly1_B 0.25 0.39 2.1e+00 3axj-assembly1_B High resolution crystal structure of C3PO
8ub8-assembly1_F 0.18 0.41 2.7e+00 8ub8-assembly1_F Diversity-generating retroelement (DGR) ribonucleoprotein reverse transcriptase - Pre-active State 1a
8ub8-assembly1_D 0.14 0.37 3.0e+00 8ub8-assembly1_D Diversity-generating retroelement (DGR) ribonucleoprotein reverse transcriptase - Pre-active State 1a
8f5h-assembly1_A 0.11 0.44 6.8e+00 8f5h-assembly1_A SARS-CoV-2 S2 helix epitope scaffold
8ube-assembly1_B 0.10 0.30 3.2e+00 8ube-assembly1_B Diversity-generating retroelement (DGR) ribonucleoprotein reverse transcriptase - Resting State 1a
6dg6-assembly4_D 0.08 0.33 3.9e+00 6dg6-assembly4_D Structure of a de novo designed Interleukin-2/Interleukin-15 mimetic
7pp1-assembly1_AAA 0.08 0.38 6.8e+00 7pp1-assembly1_AAA Crystal structure of the P2Y12 receptor in complex with the inverse agonist selatogrel.

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mshB (1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1170 mshB 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 778 778 ctx neighborhood:777
Rv0875c hyp hypothetical protein 771 771 ctx cooccurence:770
Rv0048c membrane protein 767 767 ctx cooccurence:767
Rv0822c hyp hypothetical protein 711 712 ctx cooccurence:709
Rv3202c adnA ATP-dependent DNA helicase 708 709 ctx cooccurence:708
Rv1776c transcriptional regulator 707 707 ctx cooccurence:702
Rv1635c mannosyltransferase 698 699 ctx cooccurence:698
Rv0188 transmembrane protein 693 694 ctx cooccurence:691
Rv3847 hyp hypothetical protein 693 694 ctx cooccurence:692
Rv1610 membrane protein 671 672 ctx cooccurence:668
Rv3166c hyp hypothetical protein 632 632 ctx cooccurence:630
Rv1249c membrane protein 609 609 ctx cooccurence:605
Rv3481c integral membrane protein 605 605 ctx cooccurence:604
Rv1353c HTH-type transcriptional regulator 594 594 ctx cooccurence:585
Rv3899c hyp hypothetical protein 593 593 ctx cooccurence:592

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • DeepTMHMM: 4 transmembrane helices (type TM)
  • Integral membrane topology (localisation feature, not a function)
  • DeepTMHMM topology prediction (project 'Still unknown gene function', phase8, 2026-06-10). A topological feature, not a demonstrated molecular function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215687.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AY9H
  • Curated reference: UniProt O50427 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 90.2, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 68 functional partner(s); context anchor mshB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001260|Rv1171|
MGHRVDTLSDRQRANLTTGATDRAIRLVVLALLTVDGVVSALAGALLMPWYIGSAPFPISALISGLVNAALVWAAARWTTSSRVAALPLWAWLLTVAAMSFGGPGDDVILGGQGLLVYGALVFVVAGAVPPAWVLWRRRVQADGSG