Rv0185 Family assigned · low
H37Rv Rv0185 · MTBC0 mtbc0_000198 ·
169 aa ·
216063–216572 MTBC0
(+) ·
RefSeq NP_214699.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | TIGR04338 family metallohydrolase |
| Revised (this work) | Putative metallohydrolase (PGAP TIGR04338 family). No Pfam domain above threshold, but Foldseek weakly matches an M61-type aminopeptidase fold: a possible metal-dependent hydrolase/peptidase, not firmly assigned. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv0184 (Rv0184, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4 (whiB4).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -0.09 (95% CI -1.41 to 1.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; probably involved in a cellular metabolism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0191
· 99.4% identity |
|---|---|
| M. leprae |
ML2605
· 76.4% identity |
| M. marinum |
MMAR_0429
· 79.5% identity |
| M. smegmatis |
MSMEG_0223
· 63.3% identity |
| M. orygis |
RJtmp_000199
· 99.4% identity |
| M. abscessus |
MAB_4549c
· 60.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O07429
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | TIGR04338 family metallohydrolase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2DPFG |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.545 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 53.1% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 0.700, mean read count 55.8571428571. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 26.3 ppm · rank 2148/3519 (39.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 169 aa |
|---|---|
| Molecular weight | 18.4 kDa |
| Theoretical pI | 6.75 |
| GRAVY | -0.025 (hydrophilic) |
| Aliphatic index | 84.1 |
| Aromaticity | 0.077 |
| Instability index | 32.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Tentative domain (below the --cut_ga gathering threshold; a
low-confidence homology lead, not a firm assignment): SprT-like
(PF10263.16), i-Evalue 3.7e-02,
residues 113–144 —
SprT-like family.
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 95.6 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7xyo-assembly1_A |
0.28 | 0.37 | 3.7e-01 | 7xyo-assembly1_A Crystal Structure of a M61 aminopeptidase family member from Myxococcus fulvus |
3hq2-assembly1_B |
0.20 | 0.34 | 4.7e-01 | 3hq2-assembly1_B BsuCP Crystal Structure |
7xyo-assembly1_B |
0.18 | 0.30 | 2.4e-01 | 7xyo-assembly1_B Crystal Structure of a M61 aminopeptidase family member from Myxococcus fulvus |
5k78-assembly3_C |
0.12 | 0.53 | 2.5e+00 | 5k78-assembly3_C Dbr1 in complex with 16-mer branched RNA |
2hy1-assembly1_A-2 |
0.10 | 0.53 | 3.3e+00 | 2hy1-assembly1_A-2 Crystal structure of Rv0805 |
1bqb-assembly1_A |
0.10 | 0.39 | 2.2e+00 | 1bqb-assembly1_A AUREOLYSIN, STAPHYLOCOCCUS AUREUS METALLOPROTEINASE |
8g7m-assembly1_G |
0.07 | 0.17 | 2.2e-01 | 8g7m-assembly1_G ATP-bound mtHsp60 V72I focus |
6knc-assembly1_A |
0.07 | 0.46 | 4.1e+00 | 6knc-assembly1_A PolD-PCNA-DNA (form B) |
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv0184 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | bglS (+ strand, 44 bp gap) |
| Predicted operon |
Rv0183 · Rv0184 · Rv0185 · bglS
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: bglS (beta-glucosidase BglS), high confidence from genomic context alone (score 917 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0184 hyp |
hypothetical protein | 995 | 996 ctx | neighborhood:882 cooccurence:774 coexpression:850 |
Rv0186 bglS |
beta-glucosidase BglS | 916 | 917 ctx | neighborhood:652 coexpression:770 |
Rv0183 |
lysophospholipase | 822 | 822 ctx | neighborhood:821 |
Rv2792c |
resolvase | 797 | 797 | coexpression:797 |
Rv0606 |
Possible transposase (fragment); Rv0606, (MTCY19H5.16c), len: 247 aa. Possible truncated transposase for IS_1536 element, highly similar to | 797 | 797 | coexpression:797 |
Rv2791c tnpB |
transposase | 791 | 791 | coexpression:791 |
Rv2978c tnpB |
transposase | 778 | 778 | coexpression:778 |
Rv3585 radA |
DNA repair protein RadA | 761 | 761 | coexpression:761 |
Rv3035 hyp |
hypothetical protein | 751 | 751 ctx | cooccurence:749 |
Rv0605 |
IS1536 family serine type transposase | 734 | 734 | coexpression:734 |
Rv2979c |
resolvase | 734 | 734 | coexpression:734 |
Rv2977c thiL |
thiamine-monophosphate kinase | 732 | 732 | coexpression:732 |
Rv1125 hyp |
hypothetical protein | 730 | 731 ctx | cooccurence:730 |
Rv1274 lprB |
lipoprotein LprB | 717 | 718 ctx | cooccurence:716 |
Rv1303 hyp |
hypothetical protein | 700 | 700 ctx | cooccurence:700 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: 'TIGR04338 family metallohydrolase'
- Pfam: none above threshold
- Foldseek on the ESMFold model: weak similarity to an M61 aminopeptidase (suggestive)
ESM Atlas signal (exploratory)
Ancestral protein hash cb2ac15fb8eaf37482d33c46df8308fc ·
9 ESM-space neighbours (max similarity 0.871).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 9223 |
1.13 | Active-site-adjacent scaffold patches |
| 2 | 15945 |
1.05 | Zn metalloprotease accessory regions |
| 3 | 2253 |
1.02 | Metalloprotease pre-active-site scaffold |
| 4 | 14536 |
1.00 | Metalloenzyme active site scaffold |
| 5 | 7592 |
1.00 | Post-HExxH zinc-binding segment |
| 6 | 9122 |
0.97 | Zinc metallohydrolase flanking segments |
| 7 | 10697 |
0.90 | HExxH metalloprotease active site |
| 8 | 1025 |
0.90 | Metallohydrolase N-terminal scaffold |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214699.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DPFG - Curated reference: UniProt O07429 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 95.6, very high)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
bglS - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000198|Rv0185| MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLTLPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIAVPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVYAQEGVR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0185? Email the maintainer — the message is pre-filled with this gene's details.