Rv0185 Family assigned · low

H37Rv Rv0185 · MTBC0 mtbc0_000198 · 169 aa · 216063–216572 (+) · RefSeq NP_214699.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationTIGR04338 family metallohydrolase
Revised (this work)Putative metallohydrolase (PGAP TIGR04338 family). No Pfam domain above threshold, but Foldseek weakly matches an M61-type aminopeptidase fold: a possible metal-dependent hydrolase/peptidase, not firmly assigned.

Curated reference (UniProt)

UniProt O07429 TrEMBL · unreviewed · Evidence at protein level
UniProt nameTIGR04338 family metallohydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DPFG

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.545 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.6 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7xyo-assembly1_A 0.28 0.37 3.7e-01 7xyo-assembly1_A Crystal Structure of a M61 aminopeptidase family member from Myxococcus fulvus
3hq2-assembly1_B 0.20 0.34 4.7e-01 3hq2-assembly1_B BsuCP Crystal Structure
7xyo-assembly1_B 0.18 0.30 2.4e-01 7xyo-assembly1_B Crystal Structure of a M61 aminopeptidase family member from Myxococcus fulvus
5k78-assembly3_C 0.12 0.53 2.5e+00 5k78-assembly3_C Dbr1 in complex with 16-mer branched RNA
2hy1-assembly1_A-2 0.10 0.53 3.3e+00 2hy1-assembly1_A-2 Crystal structure of Rv0805
1bqb-assembly1_A 0.10 0.39 2.2e+00 1bqb-assembly1_A AUREOLYSIN, STAPHYLOCOCCUS AUREUS METALLOPROTEINASE
8g7m-assembly1_G 0.07 0.17 2.2e-01 8g7m-assembly1_G ATP-bound mtHsp60 V72I focus
6knc-assembly1_A 0.07 0.46 4.1e+00 6knc-assembly1_A PolD-PCNA-DNA (form B)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bglS (beta-glucosidase BglS), high confidence from genomic context alone (score 917 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0184 hyp hypothetical protein 995 996 ctx neighborhood:882 cooccurence:774 coexpression:850
Rv0186 bglS beta-glucosidase BglS 916 917 ctx neighborhood:652 coexpression:770
Rv0183 lysophospholipase 822 822 ctx neighborhood:821
Rv2792c resolvase 797 797 coexpression:797
Rv0606 Possible transposase (fragment); Rv0606, (MTCY19H5.16c), len: 247 aa. Possible truncated transposase for IS_1536 element, highly similar to 797 797 coexpression:797
Rv2791c tnpB transposase 791 791 coexpression:791
Rv2978c tnpB transposase 778 778 coexpression:778
Rv3585 radA DNA repair protein RadA 761 761 coexpression:761
Rv3035 hyp hypothetical protein 751 751 ctx cooccurence:749
Rv0605 IS1536 family serine type transposase 734 734 coexpression:734
Rv2979c resolvase 734 734 coexpression:734
Rv2977c thiL thiamine-monophosphate kinase 732 732 coexpression:732
Rv1125 hyp hypothetical protein 730 731 ctx cooccurence:730
Rv1274 lprB lipoprotein LprB 717 718 ctx cooccurence:716
Rv1303 hyp hypothetical protein 700 700 ctx cooccurence:700

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'TIGR04338 family metallohydrolase'
  • Pfam: none above threshold
  • Foldseek on the ESMFold model: weak similarity to an M61 aminopeptidase (suggestive)

ESM Atlas signal (exploratory)

Ancestral protein hash cb2ac15fb8eaf37482d33c46df8308fc · 9 ESM-space neighbours (max similarity 0.871). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
19223 1.13 Active-site-adjacent scaffold patches
215945 1.05 Zn metalloprotease accessory regions
32253 1.02 Metalloprotease pre-active-site scaffold
414536 1.00 Metalloenzyme active site scaffold
57592 1.00 Post-HExxH zinc-binding segment
69122 0.97 Zinc metallohydrolase flanking segments
710697 0.90 HExxH metalloprotease active site
81025 0.90 Metallohydrolase N-terminal scaffold

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214699.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DPFG
  • Curated reference: UniProt O07429 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.6, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor bglS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000198|Rv0185|
MIGADVPRDSQRARVYAAEAFVRTLFDRVTAHGSPTVEFFGTQLTLPPEGRFGSVASVQRYVDDVLALPAVGQNWPTVSPVRVRARRAATAAHYENHGGTGTIAVPDRHTAGWAMRELVVLHEVAHHLCQVPPPHGPEFVATVCTLTELVMGPEVGHVFRVVYAQEGVR