Rv0176 Family assigned · medium auto-curated
H37Rv Rv0176 · MTBC0 mtbc0_000189 ·
322 aa ·
207800–208768 MTBC0
(+) ·
RefSeq NP_214690.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | Mce associated transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | RDD family protein |
| Revised (this work) | RDD family protein. Pfam: RDD (PF06271.19). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Evidence for diversifying selection in a set of Mycobacterium tuberculosis genes in response to antibiotic- and nonantibiotic-related pressure. doi:10.1093/molbev/mst038 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv0175 (Rv0175, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.68 (95% CI -2.07 to 4.41). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0182
· 99.4% identity |
|---|---|
| M. leprae |
ML2596
· 55.2% identity |
| M. marinum |
MMAR_0419
· 59.3% identity |
| M. smegmatis |
MSMEG_0141
· 49.5% identity |
| M. orygis |
RJtmp_000190
· 99.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O07420
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved Mce associated transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | membrane protein domain |
| Orthologous group | COG1714 |
| KEGG orthology |
K18481
|
| KEGG modules |
M00670
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 2.227 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 6 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 29.63% of strains (43030) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.298
· 12 consensus substitution(s) · 1 canettii-fixed disruption under purifying selection vs M. canettii (deep divergence; dN/dS=0.298) — a real, constrained gene predating the MTBC clonal expansion; carries 1 M. canettii-clade-fixed disruptive substitution(s) (candidate lineage-specific pseudogenisation — cross-check the intra-MTBC pseudogene layer) |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 58.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 0.933, mean read count 84.7857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) carbon sourcestress
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| heptadecanoic acid | carbon source | mutant depleted (gene required) | -1.647 | -7.933 |
| Sisomicin sulfate salt | stress | mutant enriched (loss advantageous) | 1.571 | 7.713 |
| Stearic acid | carbon source | mutant depleted (gene required) | -1.605 | -5.903 |
| Bedaquiline | stress | mutant depleted (gene required) | -1.577 | -5.883 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (4 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -3.02 | 0.011 | required |
| fitness in mouse infection (in vivo) | -2.85 | 0.0 | required |
| fitness in mouse infection, day 10 (in vivo) | -2.71 | 0.017 | required |
| fitness in mouse infection (in vivo) | -2.67 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.32 | 0.0074 | required |
| fitness in mouse infection (in vivo) | -2.14 | 0.014 | required |
| altered fitness under Meropenem (drug exposure) | +1.98 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | -1.98 | 0.019 | required |
| altered fitness under 6 weeks hypoxia (stress) | +1.11 | 0.0023 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 9 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 92.4 ppm · rank 1351/3519 (61.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (5 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 5 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 322 aa |
|---|---|
| Molecular weight | 35.4 kDa |
| Theoretical pI | 10.72 |
| GRAVY | 0.061 (hydrophobic) |
| Aliphatic index | 102.1 |
| Aromaticity | 0.068 |
| Instability index | 37.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RDD | PF06271.19 | 1.9e-14 | 21–144 | RDD family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5cnl-assembly1_A |
1.00 | 0.71 | 7.3e-06 sig | 5cnl-assembly1_A Crystal structure of an IcmL-like type IV secretion system protein (lpg0120) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.65 A resolution |
6iqt-assembly2_C |
1.00 | 0.74 | 1.1e-04 sig | 6iqt-assembly2_C Crystal Structure of CagV, a VirB8 homolog of T4SS from Helicobacter pylori Strain 26695 |
3wz4-assembly5_E |
1.00 | 0.69 | 6.6e-04 sig | 3wz4-assembly5_E Structure of the periplasmic domain of DotI (crystal form I) |
5ig3-assembly1_B |
1.00 | 0.64 | 1.5e-03 sig | 5ig3-assembly1_B Crystal structure of the human CaMKII-alpha hub |
6p7l-assembly1_D |
1.00 | 0.69 | 3.1e-03 sig | 6p7l-assembly1_D 1.8 Angstrom structure of Aln2 from Streptomyces sp. CM020 |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 12
| Upstream (5' on genome) | Rv0175 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0177 (+ strand, -4 bp gap) |
| Predicted operon |
yrbE1A · yrbE1B · mce1A · mce1B · mce1C · mce1D · lprK · mce1F · Rv0175 · Rv0176 · Rv0177 · Rv0178
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0023 (represses) · Rv0081 (represses) · Rv1049 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv0175 (Mce associated membrane protein), high confidence from genomic context alone (score 927 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0175 |
Mce associated membrane protein | 948 | 927 ctx | neighborhood:882 coexpression:409 |
Rv0178 |
Mce associated membrane protein | 915 | 887 ctx | neighborhood:801 coexpression:455 |
Rv0174 mce1F |
Mce family protein Mce1F | 926 | 845 ctx | neighborhood:713 cooccurence:408 textmining:543 |
Rv0172 mce1D |
Mce family protein Mce1D | 877 | 836 ctx | neighborhood:666 cooccurence:500 |
Rv0171 mce1C |
Mce family protein Mce1C | 873 | 829 ctx | neighborhood:659 cooccurence:499 |
Rv0169 mce1A |
Mce family protein Mce1A | 850 | 806 ctx | neighborhood:659 cooccurence:428 |
Rv0177 |
Mce associated protein | 952 | 803 ctx | neighborhood:801 textmining:767 |
Rv1797 eccE5 |
ESX-5 type VII secretion system protein EccE | 797 | 797 | coexpression:797 |
Rv0173 lprK |
Mce family lipoprotein LprK | 827 | 790 ctx | neighborhood:695 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 780 | 780 | coexpression:780 |
Rv0170 mce1B |
Mce family protein Mce1B | 864 | 731 ctx | neighborhood:659 textmining:516 |
Rv0167 yrbE1A |
membrane protein | 743 | 675 ctx | neighborhood:657 |
Rv0168 yrbE1B |
membrane protein | 870 | 670 ctx | neighborhood:665 textmining:624 |
Rv1631 coaE |
dephospho-CoA kinase CoaE | 659 | 659 | coexpression:651 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 657 | 658 ctx | cooccurence:642 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: Mce associated transmembrane protein
- MTBC0 PGAP product: RDD family protein
- Pfam (hmmscan --cut_ga): RDD PF06271.19 (E=2e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214690.1)
- Domains: Pfam-A via hmmscan --cut_ga — RDD (PF06271.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1714 - Curated reference: UniProt O07420 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
72 functional partner(s); context anchor
Rv0175 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000189|Rv0176| MTVVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMALTALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAIGPWRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRLTAAVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRDFERARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERGTPPNQRYISATVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0176? Email the maintainer — the message is pre-filled with this gene's details.