Rv0128 Family assigned · low auto-curated

H37Rv Rv0128 · MTBC0 mtbc0_000139 · 259 aa · 156013–156792 (+) · RefSeq NP_214642.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationYoaK family protein
Revised (this work)YoaK family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96805 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF1275)
Orthologous groupCOG3619

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.398 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (487) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1275PF06912.17 1.6e-3012–212 Protein of unknown function (DUF1275)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mak (maltokinase), high confidence from genomic context alone (score 795 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0127 mak maltokinase 795 795 ctx neighborhood:794
Rv0126 treS trehalose synthase/amylase TreS 717 718 ctx neighborhood:716
Rv0204c transmembrane protein 716 717 ctx cooccurence:706
Rv3820c papA2 trehalose-2-sulfate acyltransferase 690 691 ctx cooccurence:686
Rv3824c papA1 acyltransferase 684 685 ctx cooccurence:684
Rv1182 papA3 acyltransferase papA3 654 654 ctx cooccurence:652
Rv3779 transmembrane protein 634 634 ctx cooccurence:634
Rv0048c membrane protein 604 604 ctx cooccurence:602
Rv0125 pepA serine protease PepA 595 595 ctx neighborhood:593
Rv0507 mmpL2 transmembrane transport protein MmpL2 580 580 ctx cooccurence:580
Rv2942 mmpL7 transmembrane transport protein MmpL7 552 552 ctx cooccurence:552
Rv0402c mmpL1 transmembrane transport protein MmpL1 551 551 ctx cooccurence:550
Rv0450c mmpL4 transmembrane transport protein MmpL4 551 551 ctx cooccurence:551
Rv1065 hyp hypothetical protein 547 547 ctx cooccurence:547
Rv2945c lppX lipoprotein LppX 543 544 ctx cooccurence:539

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: YoaK family protein
  • Pfam (hmmscan --cut_ga): DUF1275 PF06912.17 (E=2e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214642.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1275 (PF06912.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3619
  • Curated reference: UniProt P96805 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor mak
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000139|Rv0128|
MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQRAVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGVDIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHLAGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRRGLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS