msrA Resolved · high auto-curated

H37Rv Rv0137c · MTBC0 mtbc0_000148 · 182 aa · 165058–165606 (-) · RefSeq NP_214651.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peptide methionine sulfoxide reductase MsrA
MTBC0 PGAP re-annotationpeptide-methionine (S)-S-oxide reductase MsrA
Revised (this work)Peptide-methionine (S)-S-oxide reductase MsrA. Pfam: PMSR (PF01625.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJM5 SwissProt · reviewed · Evidence at protein level
UniProt namePeptide methionine sulfoxide reductase MsrA
EC (curated) EC 1.8.4.11
Curated functionHas an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namemsrA
eggNOG descriptionHas an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine
Orthologous groupCOG0225
EC number EC 1.8.4.11, EC 1.8.4.12
KEGG orthology K07304, K12267
Gene Ontology (47) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950, GO:0006979, GO:0008113, GO:0008150, GO:0008152 +35 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.637 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PMSRPF01625.29 1.6e-575–157 Peptide methionine sulfoxide reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: msrB (peptide methionine sulfoxide reductase MsrB), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2674 msrB peptide methionine sulfoxide reductase MsrB 999 993 ctx fusion:900 cooccurence:749 coexpression:656 textmining:885
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 884 839 experimental:562 database:596
Rv0816c thiX thioredoxin ThiX 833 823 experimental:562 database:596
Rv2878c mpt53 soluble secreted antigen Mpt53 832 822 experimental:562 database:596
Rv0526 thioredoxin 832 821 experimental:562 database:596
Rv3673c membrane-anchored thioredoxin-like protein 832 821 experimental:562 database:596
Rv1677 dsbF lipoprotein DsbF 832 821 experimental:562 database:596
Rv0139 oxidoreductase 818 811 ctx neighborhood:786
Rv1629 polA DNA polymerase I 877 794 coexpression:787 textmining:429
Rv0138 hyp hypothetical protein 780 780 ctx neighborhood:779
Rv0140 hyp hypothetical protein 584 583 ctx neighborhood:582
Rv3198A glutaredoxin protein 904 525 experimental:484 textmining:807
Rv3053c nrdH glutaredoxin electron transport protein NrdH 578 513 experimental:484
Rv0508 hyp hypothetical protein 558 512 experimental:484
Rv0946c pgi glucose-6-phosphate isomerase 456 429 coexpression:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peptide methionine sulfoxide reductase MsrA
  • MTBC0 PGAP product: peptide-methionine (S)-S-oxide reductase MsrA
  • Pfam (hmmscan --cut_ga): PMSR PF01625.29 (E=2e-57)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214651.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PMSR (PF01625.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0225
  • Curated reference: UniProt P9WJM5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor msrB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000148|Rv0137c|msrA
MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRLPRRTAESALRASLSPELGT