pepA Family assigned · medium auto-curated

H37Rv Rv0125 · MTBC0 mtbc0_000136 · 355 aa · 151494–152561 (+) · RefSeq NP_214639.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)serine protease PepA
MTBC0 PGAP re-annotationS1C family serine protease
Revised (this work)S1C family serine protease. Pfam: Trypsin_2 (PF13365.13), Trypsin (PF00089.33), PDZ (PF00595.30), PDZ_2 (PF13180.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07175 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable serine protease PepA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namepepA
eggNOG descriptionserine protease
Orthologous groupCOG0265
KEGG orthology K08372
KEGG pathways map02020

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.308 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Trypsin_2PF13365.13 1.3e-2579–222 Trypsin-like peptidase domain
TrypsinPF00089.33 5.4e-1179–243 Trypsin
PDZPF00595.30 2.8e-06267–319 PDZ domain
PDZ_2PF13180.13 5.3e-12269–336 PDZ domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: treS (trehalose synthase/amylase TreS), high confidence from genomic context alone (score 797 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2115c mpa proteasome-associated ATPase 824 813 experimental:551 database:594
Rv0126 treS trehalose synthase/amylase TreS 806 797 ctx neighborhood:768
Rv3696c glpK glycerol kinase 767 753 experimental:402 database:589
Rv0127 mak maltokinase 701 701 ctx neighborhood:698
Rv1334 mec [CysO 708 698 database:576
Rv2109c prcA proteasome subunit alpha 637 620 database:562
Rv2110c prcB proteasome subunit beta 709 618 database:562
Rv2555c alaS alanine--tRNA ligase 625 612 database:586
Rv2940c mas multifunctional mycocerosic acid synthase 649 604
Rv2048c pks12 polyketide synthase 648 602
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 648 602
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 647 600
Rv1527c pks5 polyketide synthase 647 600
Rv0128 transmembrane protein 595 595 ctx neighborhood:593
Rv1293 lysA diaminopimelate decarboxylase 590 591 database:588

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: serine protease PepA
  • MTBC0 PGAP product: S1C family serine protease
  • Pfam (hmmscan --cut_ga): Trypsin_2 PF13365.13 (E=1e-25), Trypsin PF00089.33 (E=5e-11), PDZ PF00595.30 (E=3e-06), PDZ_2 PF13180.13 (E=5e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214639.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Trypsin_2 (PF13365.13), Trypsin (PF00089.33), PDZ (PF00595.30), PDZ_2 (PF13180.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0265
  • Curated reference: UniProt O07175 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 233 functional partner(s); context anchor treS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000136|Rv0125|pepA
MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLAEGPPA