Rv0138 Family assigned · medium

H37Rv Rv0138 · MTBC0 mtbc0_000149 · 167 aa · 165669–166172 MTBC0 (+) · RefSeq NP_214652.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand treS (Rv0126) — requalified: maltose alpha-D-glucosyltransferase mak (Rv0127) — requalified: maltokinase mak Rv0128 (Rv0128) — family_assigned: YoaK family protein htdZ (Rv0130) — requalified: 3-hydroxyacyl-thioester dehydratase HtdZ fgd2 (Rv0132c) — requalified: F420-dependent hydroxymycolic acid dehydrogenase fgd2 Rv0133 (Rv0133) — family_assigned: GNAT family N-acetyltransferase ephF (Rv0134) — family_assigned: alpha/beta hydrolase ephF Rv0135c (Rv0135c) — family_assigned: helix-turn-helix domain-containing protein cyp138 (Rv0136) — requalified: cytochrome P450 cyp138 msrA (Rv0137c) — requalified: peptide-methionine (S)-S-oxide reductase MsrA Rv0138 (Rv0138) — family_assigned: nuclear transport factor 2 family protein Rv0139 (Rv0139) — family_assigned: NAD-dependent epimerase/dehydratase family protein Rv0139 Rv0140 (Rv0140) — family_assigned: DUF427 domain-containing protein Rv0141c (Rv0141c) — family_assigned: nuclear transport factor 2 family protein Rv0142 (Rv0142) — requalified: DNA-3-methyladenine glycosylase Rv0142 Rv0143c (Rv0143c) — requalified: chloride channel protein Rv0143c Rv0145 (Rv0145) — requalified: class I SAM-dependent methyltransferase Rv0145 Rv0146 (Rv0146) — requalified: class I SAM-dependent methyltransferase Rv0146 Rv0148 (Rv0148) — family_assigned: SDR family oxidoreductase Rv0148 Rv0149 (Rv0149) — family_assigned: NADPH:quinone oxidoreductase family protein Rv0149 Rv0150c (Rv0150c) — dark: hypothetical protein 156 kb 160 kb 164 kb 168 kb 172 kb 176 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnuclear transport factor 2 family protein
Revised (this work)NTF2-like / SnoaL-like superfamily protein (Pfam SnoaL_4 PF13577 + SnoaL_2 PF12680). A cone fold often acting as a polyketide cyclase or hydrophobic-ligand-binding domain; the specific role is not established.
Functional category (TubercuList)conserved hypotheticals

In the literature (TB corpus sweep) 2 publications

Found under: H37Rv (1), M. bovis (1).

2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Screening of recombinant proteins as antigens in indirect ELISA for diagnosis of bovine tuberculosis. doi:10.1186/2193-1801-1-77 2012
Identification of novel Mycobacterium bovis antigens by dissection of crude protein fractions. doi:10.1128/CVI.00211-09 2009

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.94 (95% CI -0.61 to 3.36). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0143 · 98.8% identity
M. marinum MMAR_0348 · 84.9% identity
M. smegmatis MSMEG_6475 · 73.0% identity
M. orygis RJtmp_000149 · 99.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P96815 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSnoaL-like domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionSnoaL-like domain
Orthologous group2F5RB

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.468 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.146 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 78.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 51.0%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 7 growth-advantage. Saturation 1.000, mean read count 535.571428571. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance13.0 ppm · rank 2559/3519 (27.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length167 aa
Molecular weight19.0 kDa
Theoretical pI5.81
GRAVY-0.387 (hydrophilic)
Aliphatic index68.5
Aromaticity0.102
Instability index44.2 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SnoaL_4PF13577.13 2.9e-0520–106 SnoaL-like domain
SnoaL_2PF12680.14 7.2e-0724–75 SnoaL-like domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.0

PDB hitprobTM-scoreE-valueDescription
6f53-assembly1_A 1.00 0.75 1.2e-06 sig 6f53-assembly1_A CRYSTAL STRUCTURE OF KETOSTEROID ISOMERASE QUADRUPLE VARIANT V88I/L99V/D103S/V101A
6f4y-assembly2_B 1.00 0.76 2.0e-06 sig 6f4y-assembly2_B CRYSTAL STRUCTURE OF KETOSTEROID ISOMERASE VARIANT D103S
3i0y-assembly1_B 1.00 0.68 4.4e-07 sig 3i0y-assembly1_B Crystal structure of a putative polyketide cyclase (xcc0381) from xanthomonas campestris pv. campestris at 1.50 A resolution
6uad-assembly1_A 1.00 0.78 7.5e-06 sig 6uad-assembly1_A Ketosteroid isomerase (C. testosteroni) with truncated & designed loop for precise positioning of a catalytic E38
5jpu-assembly1_B 1.00 0.77 4.4e-06 sig 5jpu-assembly1_B Structure of limonene epoxide hydrolase mutant - H-2-H5 complex with (S,S)-cyclohexane-1,2-diol

Foldseek search of the AlphaFold DB model (mean pLDDT 96.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)msrA (- strand, 62 bp gap)
Downstream (3' on genome)Rv0139 (+ strand, 0 bp gap)
Predicted operon Rv0138 · Rv0139

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) mmpR5 (activates) · Rv2250c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0139 (oxidoreductase), high confidence from genomic context alone (score 914 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0139 oxidoreductase 914 914 ctx neighborhood:882
Rv0140 hyp hypothetical protein 800 800 ctx neighborhood:800
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 780 780 ctx neighborhood:779
Rv1874 hyp hypothetical protein 755 755 ctx cooccurence:755
Rv0272c hyp hypothetical protein 701 701 ctx cooccurence:701
Rv3906c hyp hypothetical protein 688 689 ctx cooccurence:688
Rv0273c transcriptional regulator 686 686 ctx cooccurence:686
Rv0311 hyp hypothetical protein 663 663 ctx cooccurence:663
Rv0767c HTH-type transcriptional regulator 650 650 ctx cooccurence:650
Rv3169 hyp hypothetical protein 648 648 ctx cooccurence:648
Rv3168 aminoglycoside phosphotransferase 626 626 ctx cooccurence:626
Rv1191 hyp hypothetical protein 609 609 ctx cooccurence:609
Rv1776c transcriptional regulator 606 606 ctx cooccurence:606
Rv0310c hyp hypothetical protein 592 592 ctx cooccurence:591
Rv1786 ferredoxin 583 584 ctx cooccurence:580

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'nuclear transport factor 2 family protein'
  • Pfam: SnoaL_4 PF13577 (E=2.9e-05), SnoaL_2 PF12680 (E=7.2e-07)

ESM Atlas signal (exploratory)

Ancestral protein hash e30e130713569e5a62a06f6ba90324d4 · 10 ESM-space neighbours (max similarity 0.954). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
13816 1.19 Acidic amphipathic surface helix
22719 1.11 Beta-edge helix cap
3690 1.07 C-terminal tail/linker activation
43387 1.05 N-terminal low-complexity IDR
52936 1.02 Charged surface beta/loop patches
66934 0.95 Active-site gating loop
74441 0.89 Short acidic-aromatic motifs
812646 0.85 Secondary-structure capping loops

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214652.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SnoaL_4 (PF13577.13), SnoaL_2 (PF12680.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2F5RB
  • Curated reference: UniProt P96815 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor Rv0139
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000149|Rv0138|
MSASEFSRAELAAAFEKFEKTVARAAATRDWDCWVQHYTPDVEYIEHAAGIMRGRQRVRAWIQETMTTFPGSHMVAFPSLWSVIDESTGRIICELDNPMLDPGDGSVISATNISIITYAGNGQWCRQEDIYNPLRFLRAAMKWCRKAQELGTLDEDAARWMRRHGGP