ephF Family assigned · medium auto-curated

H37Rv Rv0134 · MTBC0 mtbc0_000145 · 300 aa · 162117–163019 (+) · RefSeq NP_214648.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)epoxide hydrolase EphF
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96811 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible epoxide hydrolase EphF

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameephF
eggNOG descriptionepoxide hydrolase
Orthologous groupCOG2267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.66 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 1 nonsense, 4 frameshift
Disruption 5 distinct premature-stop/frameshift site(s); most common in 38.08% of strains (55294) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 1.6e-3334–281 alpha/beta hydrolase fold
Hydrolase_4PF12146.16 3.5e-0935–144 Serine aminopeptidase, S33
Abhydrolase_6PF12697.14 2.8e-1936–286 Alpha/beta hydrolase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hpx (non-heme haloperoxidase Hpx), medium confidence from genomic context alone (score 698 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3171c hpx non-heme haloperoxidase Hpx 697 698 ctx cooccurence:696
Rv0554 bpoC non-heme bromoperoxidase BpoC 559 559 ctx cooccurence:559
Rv2048c pks12 polyketide synthase 531 504 experimental:441
Rv2940c mas multifunctional mycocerosic acid synthase 530 503 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 528 501 experimental:441
Rv1527c pks5 polyketide synthase 526 499 experimental:441
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 526 498 experimental:441
Rv0077c oxidoreductase 489 489 ctx cooccurence:489
Rv0983 pepD serine protease PepD 485 484
Rv3569c hsaD 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase 472 473 ctx cooccurence:470
Rv3254 hyp hypothetical protein 471 462 ctx fusion:446
Rv2946c pks1 polyketide synthase 489 459
Rv1223 htrA serine protease HtrA 455 455
Rv0132c fgd2 F420-dependent glucose-6-phosphate dehydrogenase 454 454
Rv0125 pepA serine protease PepA 440 440

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: epoxide hydrolase EphF
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=2e-33), Hydrolase_4 PF12146.16 (E=3e-09), Abhydrolase_6 PF12697.14 (E=3e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214648.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2267
  • Curated reference: UniProt P96811 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor hpx
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000145|Rv0134|ephF
MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQNWWEWRDLIGPLAADGNRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKLVAHDWGGPVAFIMMLRHPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIGPRVISDPKGRYFRLLTGWVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREMLRWLRGEYNDARVDVPVRWLHGTGDPVITPDLLDGYAERASDFEVELVDGVGHWIVEQRPELVLDRVRAFLAAGTEQRD