lppX Resolved · high auto-curated
H37Rv Rv2945c · MTBC0 mtbc0_003128 ·
233 aa ·
3311621–3312322 MTBC0
(-) ·
RefSeq NP_217461.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LppX |
|---|---|
| MTBC0 PGAP re-annotation | LppX_LprAFG lipoprotein |
| Revised (this work) | LppX_LprAFG lipoprotein. Pfam: LppX_LprAFG (PF07161.20). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 23 publications
23 TB publications mention this gene. 23 publication(s) discuss this gene (22 in a M. tuberculosis context, 11 in other mycobacteria — M. smegmatis (7), M. leprae (4), M. abscessus (1)).
| Publication | Date |
|---|---|
| CD1a-Mediated Presentation of Canonical Microbial Peptides to T Cells. doi:10.64898/2026.05.05.723095 | 2026 |
| The role of ABC transporter DrrABC in the export of PDIM in Mycobacterium tuberculosis. doi:10.1016/j.tcsw.2024.100132 | 2024 |
| S16 and T18 mannosylation sites of LppX are not essential for its activity in phthiocerol dimycocerosates localization at the surface of Mycobacterium tuberculosis. doi:10.1016/j.resmic.2021.103874 | 2021 |
| Role of the unique, non-essential phosphatidylglycerol::prolipoprotein diacylglyceryl transferase (Lgt) in Corynebacterium glutamicum. doi:10.1099/mic.0.000937 | 2020 |
| Revisiting the expression signature of pks15/1 unveils regulatory patterns controlling phenolphtiocerol and phenolglycolipid production in pathogenic mycobacteria. doi:10.1371/journal.pone.0229700 | 2020 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 18% of residues (metapredict) · mean AlphaFold pLDDT 79.2 |
|---|---|
| Disordered regions | 1 IDR(s), longest 43 aa [0-43] |
carries a substantial disordered region (43/233 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 0.87 (95% CI -0.68 to 3.32). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2970c
· 100.0% identity |
|---|---|
| M. leprae |
ML0136
· 76.4% identity |
| M. marinum |
MMAR_1763
· 72.1% identity |
| M. orygis |
RJtmp_003037
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WK65
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative phthiocerol dimycocerosate transporter LppX |
| Curated function | Might be involved in translocating phthiocerol dimycocerosates (PDIM) from the cell membrane to the outer membrane; PDIM forms part of the cell wall. |
UniProt still lists this protein as Putative phthiocerol dimycocerosate transporter LppX; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | lppX |
| eggNOG description | Might be involved in translocating phthiocerol dimycocerosates (PDIM) from the cell membrane to the outer membrane |
| Orthologous group | 2BPGV |
| Gene Ontology (40) |
GO:0003674, GO:0005215, GO:0005319, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0006810, GO:0006869, GO:0008150, GO:0009273 +28 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.347 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 48.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 31.8% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 222.363636364. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -3.74 | 0.02 | required |
| fitness in mouse infection (in vivo) | -3.72 | 0.01 | required |
| fitness in mouse infection (in vivo) | -3.69 | 0.041 | required |
| fitness in mouse infection (in vivo) | -3.59 | 0.0 | required |
| fitness in mouse infection (in vivo) | -3.56 | 0.013 | required |
| fitness on cholesterol (vs glycerol) (carbon source) | +3.47 | 0.043 | disruption advantageous |
| fitness in mouse infection (in vivo) | -3.46 | 0.016 | required |
| fitness in mouse infection (in vivo) | -3.35 | 0.041 | required |
| fitness in mouse infection (in vivo) | -3.28 | 0.018 | required |
| fitness in mouse infection (in vivo) | -3.12 | 0.036 | required |
| fitness in mouse infection (in vivo) | -3.10 | 0.03 | required |
| fitness in mouse infection (in vivo) | -3.08 | 0.018 | required |
Conditional fitness of transposon-disruption mutants across 27 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 865.0 ppm · rank 263/3519 (92.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) lipoprotein
| Prediction | predicted lipoprotein (lipobox + signal peptide) |
|---|---|
| DeepTMHMM class | SP |
| Lipobox | signal-peptidase-II lipobox; lipidated Cys near position 19 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 233 aa |
|---|---|
| Molecular weight | 24.1 kDa |
| Theoretical pI | 5.03 |
| GRAVY | 0.013 (hydrophobic) |
| Aliphatic index | 97.9 |
| Aromaticity | 0.03 |
| Instability index | 38.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LppX_LprAFG | PF07161.20 | 5.5e-64 | 48–232 | LppX_LprAFG lipoprotein |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2byo |
X-ray diffraction | 2.15 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 79.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2byo-assembly1_A |
1.00 | 0.99 | 1.5e-32 sig | 2byo-assembly1_A Crystal structure of Mycobacterium tuberculosis lipoprotein LppX (Rv2945c) |
3mh9-assembly2_C |
1.00 | 0.71 | 9.7e-17 sig | 3mh9-assembly2_C Crystal structure of LprG mutant V91W from Mycobacterium tuberculosis |
3mha-assembly2_B |
1.00 | 0.75 | 5.5e-16 sig | 3mha-assembly2_B Crystal structure of LprG from Mycobacterium tuberculosis bound to PIM |
3mh8-assembly2_B |
1.00 | 0.76 | 1.7e-15 sig | 3mh8-assembly2_B Crystal structure of LprG from Mycobacterium tuberculosis |
4qa8-assembly1_A |
1.00 | 0.69 | 4.4e-14 sig | 4qa8-assembly1_A Crystal structure of LprF from Mycobacterium bovis |
Foldseek search of the AlphaFold DB model (mean pLDDT 79.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2944 (+ strand, 117 bp gap) |
|---|---|
| Downstream (3' on genome) | pks1 (- strand, 177 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1353c (represses) · Rv3736 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pks1 (polyketide synthase), high confidence from genomic context alone (score 880 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2946c pks1 |
polyketide synthase | 911 | 880 ctx | neighborhood:469 coexpression:783 |
Rv2942 mmpL7 |
transmembrane transport protein MmpL7 | 953 | 764 ctx | cooccurence:760 textmining:812 |
Rv2608 PPE42 |
PPE family protein PPE42 | 747 | 747 ctx | cooccurence:747 |
Rv0878c PPE13 |
PPE family protein PPE13 | 737 | 738 ctx | cooccurence:734 |
Rv2939 papA5 |
phthiocerol/phthiodiolone dimycocerosyl transferase | 785 | 731 ctx | cooccurence:587 |
Rv0442c PPE10 |
PPE family protein PPE10 | 720 | 721 ctx | cooccurence:720 |
Rv0305c PPE6 |
PPE family protein PPE6 | 707 | 708 ctx | cooccurence:707 |
Rv2932 ppsB |
phthiocerol synthesis polyketide synthase type I PpsB | 717 | 705 | coexpression:703 |
Rv3343c PPE54 |
PPE family protein PPE54 | 704 | 705 ctx | cooccurence:699 |
Rv0256c PPE2 |
PPE family protein PPE2 | 702 | 703 ctx | cooccurence:702 |
Rv0755c PPE12 |
PPE family protein PPE12 | 696 | 697 ctx | cooccurence:696 |
Rv1548c PPE21 |
PPE family protein PPE21 | 695 | 696 ctx | cooccurence:694 |
Rv1917c PPE34 |
PPE family protein PPE34 | 694 | 695 ctx | cooccurence:694 |
Rv2356c PPE40 |
Rv2356c, (MTCY98.25), len: 615 aa. PPE40, Member of Mycobacterium tuberculosis PPE_family, highly similar to others e.g. Q10778|MTCY48.17|YF | 679 | 680 ctx | cooccurence:676 |
Rv0355c PPE8 |
PPE family protein PPE8 | 675 | 675 ctx | cooccurence:674 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoprotein LppX
- MTBC0 PGAP product: LppX_LprAFG lipoprotein
- Pfam (hmmscan --cut_ga): LppX_LprAFG PF07161.20 (E=5e-64)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217461.1)
- Domains: Pfam-A via hmmscan --cut_ga — LppX_LprAFG (PF07161.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BPGV - Curated reference: UniProt P9WK65 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 79.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
91 functional partner(s); context anchor
pks1 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003128|Rv2945c|lppX MNDGKRAVTSAVLVVLGACLALWLSGCSSPKPDAEEQGVPVSPTASDPALLAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGVCTYNDEQGVPFRVQGDNISVKLFDDWSNLGSISELSTSRVLDPAAGVTQLLSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIAQDGSHHLVRASIDLGSGSIQLTQSKWNEPVNVD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lppX? Email the maintainer — the message is pre-filled with this gene's details.