Rv0140 Family assigned · medium

H37Rv Rv0140 · MTBC0 mtbc0_000151 · 126 aa · 167256–167636 (+) · RefSeq NP_214654.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF427 domain-containing protein
Revised (this work)Putative nucleotidyltransferase (Pfam NTP_transf_9 PF04248; the family formerly named DUF427). A minimal nucleotidyltransferase fold; the substrate is not established.

Curated reference (UniProt)

UniProt P96817 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF427)
Orthologous groupCOG2343

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.051 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NTP_transf_9PF04248.20 5.5e-3224–117 Domain of unknown function (DUF427)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0139 (oxidoreductase), high confidence from genomic context alone (score 800 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0139 oxidoreductase 800 800 ctx neighborhood:800
Rv0138 hyp hypothetical protein 800 800 ctx neighborhood:800
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 584 583 ctx neighborhood:582
Rv3701c egtD histidine-specific methyltransferase EtgD 467 468 ctx cooccurence:447
Rv2466c hyp hypothetical protein 664 291 textmining:546
Rv0569 hyp hypothetical protein 446 55 textmining:438
Rv0145 S-adenosylmethionine-dependent methyltransferase 655 53 textmining:651
Rv1337 integral membrane protein 552 51 textmining:548
Rv0274 hyp hypothetical protein 532 50 textmining:528
Rv0111 acyltransferase 517 48 textmining:514
Rv0711 atsA arylsulfatase AtsA 656 47 textmining:654
Rv1366 hyp hypothetical protein 632 47 textmining:630
Rv3001c ilvC ketol-acid reductoisomerase 542 46 textmining:540
Rv3407 vapB47 antitoxin VapB47 436 46 textmining:434
Rv0110 integral membrane protein 809 44 textmining:809

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'DUF427 domain-containing protein'
  • Pfam: NTP_transf_9 PF04248 (E=5.5e-32) -- putative nucleotidyltransferase (ex-DUF427)

ESM Atlas signal (exploratory)

Ancestral protein hash ece0212fdb78dd0ac92c0461699375d8 · 10 ESM-space neighbours (max similarity 0.978). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
1830 0.95 Disordered hydrophobic terminal tails
210740 0.78 Small residue segment preference
36702 0.54 Glycine-rich N-terminal leaders
47615 0.53 TM-adjacent disordered tails and linkers
51855 0.49 Pro/Gly-rich disordered linkers
65835 0.46 Conserved functional core segments
712482 0.46 N-terminal anion-binding capping loops
815589 0.43 Mid-chain hydrophobic core

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214654.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NTP_transf_9 (PF04248.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2343
  • Curated reference: UniProt P96817 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor Rv0139
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000151|Rv0140|
MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEASYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPAVAAIAGHVACYPDKAEISIFPG