Rv1065 Family assigned · medium auto-curated

H37Rv Rv1065 · MTBC0 mtbc0_001145 · 188 aa · 1194774–1195340 (+) · RefSeq NP_215581.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationcysteine dioxygenase family protein
Revised (this work)Cysteine dioxygenase family protein. Pfam: CDO_I (PF05995.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53413 TrEMBL · unreviewed · Evidence at protein level
UniProt nameCysteine dioxygenase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namecdoA
eggNOG descriptioncysteine dioxygenase
Orthologous groupCOG1917

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.36 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CDO_IPF05995.19 2.9e-0856–117 Cysteine dioxygenase type I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3249c (TetR family transcriptional regulator), medium confidence from genomic context alone (score 686 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1066 hyp hypothetical protein 996 996 ctx neighborhood:836 fusion:615 cooccurence:631 coexpression:860
Rv3249c TetR family transcriptional regulator 685 686 ctx cooccurence:683
Rv1747 ABC transporter ATP-binding protein/permease 573 574 ctx cooccurence:571
Rv1064c lpqV lipoprotein LpqV 572 572 ctx neighborhood:568
Rv0128 transmembrane protein 547 547 ctx cooccurence:547
Rv0184 hyp hypothetical protein 542 543 ctx cooccurence:540
Rv0485 transcriptional regulator 521 521
Rv3118 sseC1 hyp hypothetical protein 496 497 ctx cooccurence:480
Rv0814c sseC2 hyp hypothetical protein 486 487 ctx cooccurence:480
Rv1845c blaR sensor-transducer protein BlaR 450 450 ctx cooccurence:444
Rv1639c hyp hypothetical protein 432 432 ctx cooccurence:424
Rv3035 hyp hypothetical protein 426 427 ctx cooccurence:423
Rv1063c NTE family protein 423 423 ctx neighborhood:421
Rv3818 hyp hypothetical protein 400 401
Rv3820c papA2 trehalose-2-sulfate acyltransferase 400 400 ctx cooccurence:400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: cysteine dioxygenase family protein
  • Pfam (hmmscan --cut_ga): CDO_I PF05995.19 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215581.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CDO_I (PF05995.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1917
  • Curated reference: UniProt O53413 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv3249c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001145|Rv1065|
MVMPLVTPTTAVPSPGPTRLRVADLLRATDQAADDVLGGRCDHLLPDGGVPQTQRWYTRIHGDEELDIWLISWVPGQPTELHDHGGSLGALTVLSGSLNEYRWDGRRLRRRRLDAGDQAGFPLGWVHDVVWAPRPIGGPDAAGMAVAPTLSVHAYSPPLTAMSYYEITERNTLRRQRTELTDQPEGSG