papA3 Resolved · high auto-curated
H37Rv Rv1182 · MTBC0 mtbc0_001270 ·
472 aa ·
1328477–1329895 MTBC0
(+) ·
RefSeq NP_215698.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acyltransferase papA3 |
|---|---|
| MTBC0 PGAP re-annotation | acyltransferase PapA3 |
| Revised (this work) | Acyltransferase PapA3. Pfam: Condensation (PF00668.26). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| The rv1184c locus encodes Chp2, an acyltransferase in Mycobacterium tuberculosis polyacyltrehalose lipid biosynthesis. doi:10.1128/JB.02015-14 | 2015 |
| Biosynthesis and translocation of unsulfated acyltrehaloses in Mycobacterium tuberculosis. doi:10.1074/jbc.M114.581199 | 2014 |
| PapA3 is an acyltransferase required for polyacyltrehalose biosynthesis in Mycobacterium tuberculosis. doi:10.1074/jbc.M809088200 | 2009 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.24 (95% CI -0.62 to 3.91). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; thought to be involved in lipid metabolism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1214
· 100.0% identity |
|---|---|
| M. leprae |
ML1230
· 75.8% identity |
| M. smegmatis |
MSMEG_0409
· 54.8% identity |
| M. orygis |
RJtmp_001246
· 99.8% identity |
| M. abscessus |
MAB_0938c
· 55.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIK5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Acyltransferase PapA3 |
| EC (curated) |
EC 2.3.1.278, EC 2.3.1.279
|
| Curated function | Involved in the biosynthesis of polyacyltrehalose (PAT), a pentaacylated, trehalose-based glycolipid that could have a role in anchoring the bacterial capsule. Catalyzes the sequential transfer of two palmitoyl groups onto a single glucose residue of trehalose generating the diacylated product 2,3-diacyltrehalose (trehalose dipalmitate). Although palmitoyl-CoA (PCoA) seems to be the physiological acyl donor, PapA3 can also use docosanoyl (22-carbon saturated fatty acid) coenzyme A as acyl donor. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | papA3 |
| eggNOG description | COG1020 Non-ribosomal peptide synthetase modules and related proteins |
| Orthologous group | COG1020 |
| Gene Ontology (31) |
GO:0003674, GO:0003824, GO:0005975, GO:0005984, GO:0005991, GO:0006629, GO:0006643, GO:0006664, GO:0008150, GO:0008152, GO:0008610, GO:0009058 +19 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.186 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 7 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 57.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 37.6% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 40 in the ORF — 0 in the essential state, 0 growth-defect, 40 non-essential, 0 growth-advantage. Saturation 0.875, mean read count 55.4. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -1.33 | 0.0 | required |
| fitness in mouse infection (in vivo) | -1.19 | 0.0 | required |
| fitness in mouse infection (in vivo) | -1.07 | 0.035 | required |
Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 33.0 ppm · rank 2016/3519 (42.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 472 aa |
|---|---|
| Molecular weight | 51.6 kDa |
| Theoretical pI | 5.52 |
| GRAVY | -0.071 (hydrophilic) |
| Aliphatic index | 81.2 |
| Aromaticity | 0.093 |
| Instability index | 35.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Condensation | PF00668.26 | 1.5e-18 | 54–468 | Condensation domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6aef-assembly1_A |
1.00 | 0.96 | 4.6e-65 sig | 6aef-assembly1_A PapA2 acyl transferase |
6p1j-assembly2_B |
1.00 | 0.70 | 9.3e-22 sig | 6p1j-assembly2_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module |
8qnf-assembly1_A |
1.00 | 0.71 | 3.4e-21 sig | 8qnf-assembly1_A Crystal structure of the Condensation domain TomBC from the Tomaymycin non-ribosomal peptide synthetase |
6p1j-assembly1_A |
1.00 | 0.69 | 1.2e-21 sig | 6p1j-assembly1_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module |
8rz6-assembly1_A |
1.00 | 0.72 | 2.4e-20 sig | 8rz6-assembly1_A SeMet derivative structure of the condensation domain TomBC from the Tomaymycin non-ribosomal peptide synthetase |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | pks4 (+ strand, 52 bp gap) |
|---|---|
| Downstream (3' on genome) | mmpL10 (+ strand, 66 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1353c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pks4 (polyketide beta-ketoacyl synthase), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1181 pks4 exp |
polyketide beta-ketoacyl synthase | 997 | 989 ctx | neighborhood:648 coexpression:917 experimental:473 textmining:786 |
Rv1183 mmpL10 |
transmembrane transport protein MmpL10 | 992 | 948 ctx | neighborhood:628 coexpression:806 textmining:858 |
Rv1180 pks3 |
polyketide beta-ketoacyl synthase | 963 | 927 ctx | neighborhood:513 coexpression:815 textmining:528 |
Rv3825c pks2 exp |
phthioceranic/hydroxyphthioceranic acid synthase | 956 | 915 | coexpression:597 experimental:721 textmining:515 |
Rv1527c pks5 exp |
polyketide synthase | 903 | 888 | coexpression:466 experimental:721 |
Rv2940c mas exp |
multifunctional mycocerosic acid synthase | 912 | 886 | coexpression:469 experimental:721 |
Rv2048c pks12 exp |
polyketide synthase | 887 | 864 | coexpression:469 experimental:721 |
Rv2933 ppsC exp |
phthiocerol synthesis polyketide synthase type I PpsC | 883 | 864 | coexpression:469 experimental:721 |
Rv3800c pks13 exp |
polyketide synthase | 891 | 858 | coexpression:661 experimental:473 |
Rv2377c mbtH hyp exp |
hypothetical protein | 761 | 747 | coexpression:424 experimental:564 |
Rv2946c pks1 exp |
polyketide synthase | 799 | 731 | coexpression:442 experimental:473 |
Rv1661 pks7 exp |
polyketide synthase | 754 | 725 | coexpression:443 experimental:473 |
Rv2932 ppsB exp |
phthiocerol synthesis polyketide synthase type I PpsB | 749 | 722 | coexpression:443 experimental:473 |
Rv0210 hyp |
hypothetical protein | 716 | 717 ctx | cooccurence:715 |
Rv2383c mbtB |
phenyloxazoline synthase | 809 | 715 | coexpression:678 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acyltransferase papA3
- MTBC0 PGAP product: acyltransferase PapA3
- Pfam (hmmscan --cut_ga): Condensation PF00668.26 (E=1e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215698.1)
- Domains: Pfam-A via hmmscan --cut_ga — Condensation (PF00668.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt P9WIK5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
112 functional partner(s); context anchor
pks4 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001270|Rv1182|papA3 MLRVGPLTIGTLDDWAPSTGSTVSWRPSAVAHTKASQAPISDVPVSYMQAQHIRGYCEQKAKGLDYSRLMVVSCQQPGQCDIRAANYVINAHLRRHDTYRSWFQYNGNGQIIRRTIQDPADIEFVPVHHGELTLPQIREIVQNTPDPLQWGCFRFGIVQGCDHFTFFASVDHVHVDAMIVGVTLMEFHLMYAALVGGHAPLELPPAGSYDDFCRRQHTFSSTLTVESPQVRAWTKFAEGTNGSFPDFPLPLGDPSKPSDADIVTVMMLDEEQTAQFESVCTAAGARFIGGVLACCGLAEHELTGTTTYYGLTPRDTRRTPADAMTQGWFTGLIPITVPIAGSAFGDAARAAQTSFDSGVKLAEVPYDRVVELSSTLTMPRPNFPVVNFLDAGAAPLSVLLTAELTGTNIGVYSDGRYSYQLSIYVIRVEQGTAVAVMFPDNPIARESVARYLATLKSVFQRVAESGQQQNVA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for papA3? Email the maintainer — the message is pre-filled with this gene's details.