fgd2 Resolved · high auto-curated

H37Rv Rv0132c · MTBC0 mtbc0_000143 · 360 aa · 160046–161128 (-) · RefSeq NP_214646.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)F420-dependent glucose-6-phosphate dehydrogenase
MTBC0 PGAP re-annotationF420-dependent hydroxymycolic acid dehydrogenase
Revised (this work)F420-dependent hydroxymycolic acid dehydrogenase. Pfam: Bac_luciferase (PF00296.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96809 SwissProt · reviewed · Evidence at protein level
UniProt nameF420-dependent hydroxymycolic acid dehydrogenase
EC (curated) EC 1.1.98.-
Curated functionCatalyzes the coenzyme F420-dependent oxidation of hydroxymycolic acids (H-MAs) to ketomycolic acids (K-MAs), a lipid class making up the mycobacterial pseudo-outer membrane and over one-third of the dry weight of M.tuberculosis. Does not exhibit F420-dependent glucose-6-phosphate dehydrogenase (FGD) activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namefgd2
eggNOG descriptionLuciferase-like monooxygenase
Orthologous groupCOG2141
EC number EC 1.1.98.2
KEGG orthology K15510
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.697 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 2 nonsense, 1 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (382) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_luciferasePF00296.27 2.3e-5448–281 Luciferase-like monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0044c (oxidoreductase), high confidence from genomic context alone (score 765 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0044c oxidoreductase 765 765 ctx cooccurence:763
Rv3261 fbiA 2-phospho-L-lactate transferase 878 758 ctx cooccurence:750 textmining:520
Rv3262 fbiB coenzyme F420:L-glutamate ligase 888 735 ctx cooccurence:701 textmining:596
Rv3547 ddn deazaflavin-dependent nitroreductase 889 731 ctx cooccurence:731 textmining:605
Rv3520c coenzyme F420-dependent oxidoreductase 727 727 ctx cooccurence:726
Rv3178 nitroreductase 731 715 ctx cooccurence:712
Rv0131c fadE1 acyl-CoA dehydrogenase FadE1 713 713 ctx neighborhood:687
Rv2983 cofC 2-phospho-L-lactate guanylyltransferase 795 712 ctx cooccurence:700
Rv1261c hyp hypothetical protein 709 710 ctx cooccurence:708
Rv3093c oxidoreductase 705 705 ctx cooccurence:705
Rv1558 hyp hypothetical protein 704 693 ctx cooccurence:693
Rv3072c hyp hypothetical protein 688 689 ctx cooccurence:688
Rv1936 monooxygenase 623 624 ctx cooccurence:620
Rv0133 GCN5-like N-acetyltransferase 571 571 ctx neighborhood:557
Rv0134 ephF epoxide hydrolase EphF 454 454

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: F420-dependent glucose-6-phosphate dehydrogenase
  • MTBC0 PGAP product: F420-dependent hydroxymycolic acid dehydrogenase
  • Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=2e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214646.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2141
  • Curated reference: UniProt P96809 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor Rv0044c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000143|Rv0132c|fgd2
MTGISRRTFGLAAGFGAIGAGGLGGGCSTRSGPTPTPEPASRGVGVVLSHEQFRTDRLVAHAQAAEQAGFRYVWASDHLQPWQDNEGHSMFPWLTLALVGNSTSSILFGTGVTCPIYRYHPATVAQAFASLAILNPGRVFLGLGTGERLNEQAATDTFGNYRERHDRLIEAIVLIRQLWSGERISFTGHYFRTDELKLYDTPAMPPPIFVAASGPQSATLAGRYGDGWIAQARDINDAKLLAAFAAGAQAAGRDPTTLGKRAELFAVVGDDKAAARAADLWRFTAGAVDQPNPVEIQRAAESNPIEKVLANWAVGTDPGVHIGAVQAVLDAGAVPFLHFPQDDPITAIDFYRTNVLPELR