nmtR Resolved · high auto-curated

H37Rv Rv3744 · MTBC0 mtbc0_003967 · 120 aa · 4219561–4219923 (+) · RefSeq NP_218261.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator NmtR
MTBC0 PGAP re-annotationNi(II)/Co(II)-sensing metalloregulatory transcriptional repressor NmtR
Revised (this work)Ni(II)/Co(II)-sensing metalloregulatory transcriptional repressor NmtR. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27), HTH_IclR (PF09339.17), HTH_24 (PF13412.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69711 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator NmtR
Curated functionRepresses transcription of ctpJ/nmtA, by binding to its promoter region.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namenmtR
eggNOG descriptionhelix_turn_helix, Arsenical Resistance Operon Repressor
Orthologous groupCOG0640
KEGG orthology K21886
Gene Ontology (11) GO:0008150, GO:0010565, GO:0019216, GO:0019217, GO:0019222, GO:0031323, GO:0050789, GO:0050794, GO:0062012, GO:0065007, GO:0080090

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 3.8e-1030–77 Helix-turn-helix domain
HTH_5PF01022.27 7.4e-1633–76 Bacterial regulatory protein, arsR family
HTH_IclRPF09339.17 1.3e-0543–79 IclR helix-turn-helix domain
HTH_24PF13412.13 9.1e-0543–76 Winged helix-turn-helix DNA-binding

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ctpJ (cation transporter ATPase J), high confidence from genomic context alone (score 774 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3743c ctpJ cation transporter ATPase J 889 774 ctx neighborhood:580 textmining:532
Rv0894 transcriptional regulator 731 731 coexpression:731
Rv1359 transcriptional regulator 703 703 coexpression:703
Rv1469 ctpD cobalt/nickel-exporting P-type ATPase 662 467
Rv2359 zur zinc uptake regulation protein 655 438 textmining:413
Rv0081 HTH-type transcriptional regulator 465 388
Rv2643 arsC arsenic-transport integral membrane protein ArsC 457 377
Rv1674c transcriptional regulator 656 285 textmining:540
Rv0827c kmtR HTH-type transcriptional regulator KmtR 438 276
Rv2358 smtB HTH-type transcriptional regulator SmtB 408 234
Rv1470 trxA thioredoxin TrxA 556 99 textmining:528
Rv2641 cadI cadmium inducible protein CadI 655 89 textmining:638
Rv2640c ArsR family transcriptional regulator 590 83 textmining:572
Rv2025c cation efflux system protein 872 80 textmining:867
Rv2034 ArsR family HTH-type transcriptional repressor 549 47 textmining:547

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator NmtR
  • MTBC0 PGAP product: Ni(II)/Co(II)-sensing metalloregulatory transcriptional repressor NmtR
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=4e-10), HTH_5 PF01022.27 (E=7e-16), HTH_IclR PF09339.17 (E=1e-05), HTH_24 PF13412.13 (E=9e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218261.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27), HTH_IclR (PF09339.17), HTH_24 (PF13412.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0640
  • Curated reference: UniProt O69711 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor ctpJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003967|Rv3744|nmtR
MGHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDEAIYHSEHLHLGLSDRHPSAG