Rv3735 Resolved · high auto-curated
H37Rv Rv3735 · MTBC0 mtbc0_003960 ·
162 aa · 4210210–4210698 (+) ·
RefSeq NP_218252.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | adenosine-specific kinase |
| Revised (this work) | Adenosine-specific kinase. Pfam: Adenosine_kin (PF04008.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O69702
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Adenosine specific kinase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Adenosine specific kinase |
| Orthologous group | COG1839 |
| KEGG orthology |
K09129
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.342 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Adenosine_kin | PF04008.20 | 6.4e-73 | 8–161 | Adenosine specific kinase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3736 (AraC/XylS family transcriptional regulator), medium confidence from genomic context alone (score 649 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3736 |
AraC/XylS family transcriptional regulator | 649 | 649 ctx | neighborhood:647 |
Rv3737 |
transmembrane protein | 647 | 647 ctx | neighborhood:646 |
Rv3733c hyp |
hypothetical protein | 534 | 533 ctx | neighborhood:526 |
Rv3734c tgs2 |
diacyglycerol O-acyltransferase | 515 | 515 ctx | neighborhood:508 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: adenosine-specific kinase
- Pfam (hmmscan --cut_ga): Adenosine_kin PF04008.20 (E=6e-73)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218252.1)
- Domains: Pfam-A via hmmscan --cut_ga — Adenosine_kin (PF04008.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1839 - Curated reference: UniProt O69702 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
4 functional partner(s); context anchor
Rv3736 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003960|Rv3735| MSLAWDVVSVDKPDDVNVVIGQAHFIKAVEDLHEAMVGVSPSLRFGLAFCEASGPRLVRHTGNDGDLVELATRTALAIAAGHSFVIFLREGFPINILNPVQAVPEVCTIYCATANPVDVVVAVTPHGRGIVGVVDGQTPLGVETDRDIAQRRDLLRAIGYKL